Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QY487_RS11610 Genome accession   NZ_CP129459
Coordinates   2422904..2423341 (-) Length   145 a.a.
NCBI ID   WP_025852922.1    Uniprot ID   -
Organism   Bacillus velezensis strain SSF6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2417904..2428341
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QY487_RS11560 (QY487_11560) sinI 2418289..2418462 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  QY487_RS11565 (QY487_11565) sinR 2418496..2418831 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QY487_RS11570 (QY487_11570) tasA 2418879..2419664 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  QY487_RS11575 (QY487_11575) sipW 2419728..2420312 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QY487_RS11580 (QY487_11580) tapA 2420284..2420955 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  QY487_RS11585 (QY487_11585) - 2421214..2421543 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  QY487_RS11590 (QY487_11590) - 2421583..2421762 (-) 180 WP_003153093.1 YqzE family protein -
  QY487_RS11595 (QY487_11595) comGG 2421819..2422196 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  QY487_RS11600 (QY487_11600) comGF 2422197..2422592 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  QY487_RS11605 (QY487_11605) comGE 2422606..2422920 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  QY487_RS11610 (QY487_11610) comGD 2422904..2423341 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  QY487_RS11615 (QY487_11615) comGC 2423331..2423639 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QY487_RS11620 (QY487_11620) comGB 2423644..2424681 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  QY487_RS11625 (QY487_11625) comGA 2424668..2425738 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  QY487_RS11630 (QY487_11630) - 2425930..2426880 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -
  QY487_RS11635 (QY487_11635) - 2427026..2428327 (+) 1302 WP_094247732.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16268.78 Da        Isoelectric Point: 10.1850

>NTDB_id=853459 QY487_RS11610 WP_025852922.1 2422904..2423341(-) (comGD) [Bacillus velezensis strain SSF6]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=853459 QY487_RS11610 WP_025852922.1 2422904..2423341(-) (comGD) [Bacillus velezensis strain SSF6]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552