Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QY487_RS11560 Genome accession   NZ_CP129459
Coordinates   2418289..2418462 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SSF6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2413289..2423462
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QY487_RS11545 (QY487_11545) gcvT 2414106..2415206 (-) 1101 WP_094247736.1 glycine cleavage system aminomethyltransferase GcvT -
  QY487_RS11550 (QY487_11550) - 2415630..2417300 (+) 1671 WP_069013074.1 SNF2-related protein -
  QY487_RS11555 (QY487_11555) - 2417318..2418112 (+) 795 WP_014305407.1 YqhG family protein -
  QY487_RS11560 (QY487_11560) sinI 2418289..2418462 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  QY487_RS11565 (QY487_11565) sinR 2418496..2418831 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QY487_RS11570 (QY487_11570) tasA 2418879..2419664 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  QY487_RS11575 (QY487_11575) sipW 2419728..2420312 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QY487_RS11580 (QY487_11580) tapA 2420284..2420955 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  QY487_RS11585 (QY487_11585) - 2421214..2421543 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  QY487_RS11590 (QY487_11590) - 2421583..2421762 (-) 180 WP_003153093.1 YqzE family protein -
  QY487_RS11595 (QY487_11595) comGG 2421819..2422196 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  QY487_RS11600 (QY487_11600) comGF 2422197..2422592 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  QY487_RS11605 (QY487_11605) comGE 2422606..2422920 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  QY487_RS11610 (QY487_11610) comGD 2422904..2423341 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=853455 QY487_RS11560 WP_003153105.1 2418289..2418462(+) (sinI) [Bacillus velezensis strain SSF6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=853455 QY487_RS11560 WP_003153105.1 2418289..2418462(+) (sinI) [Bacillus velezensis strain SSF6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702