Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   QY487_RS01985 Genome accession   NZ_CP129459
Coordinates   388604..388723 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SSF6     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 383604..393723
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QY487_RS01970 (QY487_01970) - 385216..385899 (+) 684 WP_094247243.1 response regulator transcription factor -
  QY487_RS01975 (QY487_01975) - 385886..387319 (+) 1434 WP_161941456.1 HAMP domain-containing sensor histidine kinase -
  QY487_RS01980 (QY487_01980) rapC 387472..388620 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  QY487_RS01985 (QY487_01985) phrC 388604..388723 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QY487_RS01990 (QY487_01990) - 388873..388968 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  QY487_RS01995 (QY487_01995) - 389063..390427 (-) 1365 WP_070081361.1 aspartate kinase -
  QY487_RS02000 (QY487_02000) ceuB 390842..391795 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  QY487_RS02005 (QY487_02005) - 391785..392732 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  QY487_RS02010 (QY487_02010) - 392726..393484 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=853425 QY487_RS01985 WP_003156334.1 388604..388723(+) (phrC) [Bacillus velezensis strain SSF6]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=853425 QY487_RS01985 WP_003156334.1 388604..388723(+) (phrC) [Bacillus velezensis strain SSF6]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718