Detailed information    

insolico Bioinformatically predicted

Overview


Name   exbB   Type   Machinery gene
Locus tag   QYP03_RS05880 Genome accession   NZ_CP129402
Coordinates   1356150..1356785 (-) Length   211 a.a.
NCBI ID   WP_046382924.1    Uniprot ID   A0A2N7YSQ7
Organism   Pseudomonas veronii strain OST1911     
Function   ssDNA transport through the inner membrane (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1333811..1359108 1356150..1356785 within 0


Gene organization within MGE regions


Location: 1333811..1359108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYP03_RS05715 (QYP03_05715) - 1335054..1335488 (-) 435 WP_301556360.1 hypothetical protein -
  QYP03_RS05720 (QYP03_05720) - 1335616..1335786 (+) 171 Protein_1139 integrase -
  QYP03_RS05725 (QYP03_05725) - 1336494..1338158 (+) 1665 WP_301556361.1 hypothetical protein -
  QYP03_RS05730 (QYP03_05730) - 1338831..1339958 (+) 1128 WP_301556362.1 hypothetical protein -
  QYP03_RS05735 (QYP03_05735) - 1340126..1341345 (+) 1220 WP_227778763.1 IS3 family transposase -
  QYP03_RS05740 (QYP03_05740) - 1341610..1342014 (+) 405 WP_152032031.1 hypothetical protein -
  QYP03_RS05745 (QYP03_05745) - 1342092..1342382 (-) 291 WP_301556363.1 hypothetical protein -
  QYP03_RS05750 (QYP03_05750) - 1342531..1342845 (-) 315 WP_046383008.1 hypothetical protein -
  QYP03_RS05755 (QYP03_05755) - 1342951..1343097 (-) 147 WP_231589895.1 hypothetical protein -
  QYP03_RS05760 (QYP03_05760) - 1343432..1343770 (-) 339 WP_046383006.1 hypothetical protein -
  QYP03_RS05765 (QYP03_05765) - 1344084..1344488 (+) 405 WP_363325613.1 hypothetical protein -
  QYP03_RS05770 (QYP03_05770) - 1344520..1344696 (+) 177 WP_301556365.1 hypothetical protein -
  QYP03_RS05775 (QYP03_05775) - 1344689..1345123 (-) 435 WP_046383005.1 hypothetical protein -
  QYP03_RS05780 (QYP03_05780) - 1345318..1345689 (-) 372 WP_233099115.1 hypothetical protein -
  QYP03_RS05785 (QYP03_05785) yejK 1345789..1346795 (+) 1007 Protein_1152 nucleoid-associated protein YejK -
  QYP03_RS05790 (QYP03_05790) - 1347117..1347317 (-) 201 WP_156179907.1 hypothetical protein -
  QYP03_RS05795 (QYP03_05795) - 1347450..1347848 (-) 399 WP_156179904.1 hypothetical protein -
  QYP03_RS05800 (QYP03_05800) - 1347923..1348899 (+) 977 Protein_1155 DNA cytosine methyltransferase -
  QYP03_RS05805 (QYP03_05805) - 1349009..1349401 (-) 393 WP_046383004.1 hypothetical protein -
  QYP03_RS05810 (QYP03_05810) - 1349440..1349598 (+) 159 WP_156179900.1 hypothetical protein -
  QYP03_RS05815 (QYP03_05815) - 1349645..1349845 (+) 201 WP_046383003.1 hypothetical protein -
  QYP03_RS05820 (QYP03_05820) - 1349917..1350357 (+) 441 WP_046383002.1 hypothetical protein -
  QYP03_RS05825 (QYP03_05825) - 1350315..1350620 (+) 306 Protein_1160 SAM-dependent methyltransferase -
  QYP03_RS05830 (QYP03_05830) - 1350680..1350865 (+) 186 WP_046383001.1 hypothetical protein -
  QYP03_RS05835 (QYP03_05835) - 1350945..1351181 (+) 237 Protein_1162 integrase -
  QYP03_RS05845 (QYP03_05845) - 1351519..1352190 (+) 672 WP_057004407.1 Bax inhibitor-1/YccA family protein -
  QYP03_RS05850 (QYP03_05850) murB 1352265..1353284 (-) 1020 WP_017848009.1 UDP-N-acetylmuramate dehydrogenase -
  QYP03_RS05855 (QYP03_05855) - 1353281..1353745 (-) 465 WP_017848010.1 low molecular weight protein-tyrosine-phosphatase -
  QYP03_RS05860 (QYP03_05860) kdsB 1353745..1354509 (-) 765 WP_017848011.1 3-deoxy-manno-octulosonate cytidylyltransferase -
  QYP03_RS05865 (QYP03_05865) - 1354506..1354691 (-) 186 WP_003174668.1 Trm112 family protein -
  QYP03_RS05870 (QYP03_05870) lpxK 1354715..1355725 (-) 1011 WP_046382926.1 tetraacyldisaccharide 4'-kinase -
  QYP03_RS05875 (QYP03_05875) - 1355725..1356153 (-) 429 WP_046382925.1 biopolymer transporter ExbD -
  QYP03_RS05880 (QYP03_05880) exbB 1356150..1356785 (-) 636 WP_046382924.1 MotA/TolQ/ExbB proton channel family protein Machinery gene
  QYP03_RS05885 (QYP03_05885) comA 1356895..1359108 (-) 2214 WP_301556366.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene

Sequence


Protein


Download         Length: 211 a.a.        Molecular weight: 22884.02 Da        Isoelectric Point: 7.3613

>NTDB_id=853024 QYP03_RS05880 WP_046382924.1 1356150..1356785(-) (exbB) [Pseudomonas veronii strain OST1911]
MWELVKSGGWMMLPIILSSIAALGIVAERLWTLRASRVTPEHLLGQVWGWIKNKQLDKQKLKELRANSPLGEILAAGLAN
SKHGREIMKECIEEAAARVIHELERYINALGTIAAMAPLLGLLGTVLGMIDIFSSFMGSGMSTNAAVLAGGISKALITTA
AGLMVGIPSVFFHRFLQRRIDELVVGMEQEAIKLVEVVQGDRDVDLVGDKA

Nucleotide


Download         Length: 636 bp        

>NTDB_id=853024 QYP03_RS05880 WP_046382924.1 1356150..1356785(-) (exbB) [Pseudomonas veronii strain OST1911]
GTGTGGGAATTGGTCAAATCCGGCGGCTGGATGATGTTGCCGATCATCTTGAGCTCCATCGCCGCACTCGGCATCGTTGC
CGAACGCCTGTGGACCTTGCGCGCCAGCCGTGTCACGCCCGAGCATCTGCTGGGGCAGGTCTGGGGCTGGATCAAGAACA
AGCAGCTCGACAAGCAGAAACTCAAGGAACTGCGTGCCAATTCACCCCTGGGTGAAATCCTCGCGGCCGGGCTGGCCAAC
TCCAAGCATGGTCGCGAGATCATGAAAGAGTGCATCGAAGAGGCCGCCGCGCGGGTCATCCATGAGCTGGAGCGTTATAT
CAACGCCCTCGGCACCATCGCCGCCATGGCACCGTTGCTCGGCCTGCTGGGCACGGTGCTGGGCATGATCGATATTTTCA
GCTCGTTCATGGGCTCGGGCATGAGCACCAACGCCGCGGTGCTGGCCGGTGGTATCTCCAAGGCCCTGATCACCACGGCA
GCGGGCCTGATGGTCGGTATTCCCTCGGTGTTCTTCCACCGTTTCCTGCAACGCCGGATCGATGAGTTGGTGGTCGGCAT
GGAGCAGGAAGCCATCAAACTGGTGGAAGTGGTGCAGGGCGATCGTGACGTGGACTTGGTCGGGGACAAAGCGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2N7YSQ7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  exbB Pseudomonas stutzeri DSM 10701

85.308

100

0.853