Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   QYE82_RS07565 Genome accession   NZ_CP129374
Coordinates   1607619..1608494 (-) Length   291 a.a.
NCBI ID   WP_002457371.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain CSMH-411EB     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1565525..1643928 1607619..1608494 within 0


Gene organization within MGE regions


Location: 1565525..1643928
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYE82_RS07395 pgsA 1566214..1566795 (-) 582 WP_002446313.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  QYE82_RS07400 - 1566824..1567216 (-) 393 WP_002457351.1 RodZ family helix-turn-helix domain-containing protein -
  QYE82_RS07405 - 1567235..1568062 (-) 828 WP_002457352.1 YmfK family protein -
  QYE82_RS07410 - 1568215..1568919 (-) 705 WP_301560353.1 SDR family oxidoreductase -
  QYE82_RS07415 - 1568916..1570205 (-) 1290 WP_032604446.1 pitrilysin family protein -
  QYE82_RS07420 - 1570205..1571476 (-) 1272 WP_038812976.1 pitrilysin family protein -
  QYE82_RS07425 - 1571506..1572219 (-) 714 WP_002457355.1 GntR family transcriptional regulator -
  QYE82_RS07430 - 1572222..1574615 (-) 2394 WP_145368324.1 DNA translocase FtsK -
  QYE82_RS07435 - 1574882..1576555 (-) 1674 WP_002457357.1 ribonuclease J -
  QYE82_RS07440 pnp 1576925..1579030 (-) 2106 WP_002446305.1 polyribonucleotide nucleotidyltransferase -
  QYE82_RS07445 rpsO 1579162..1579431 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  QYE82_RS07450 - 1579550..1580521 (-) 972 WP_038812973.1 bifunctional riboflavin kinase/FAD synthetase -
  QYE82_RS07455 truB 1580537..1581454 (-) 918 WP_020363147.1 tRNA pseudouridine(55) synthase TruB -
  QYE82_RS07460 rbfA 1581592..1581942 (-) 351 WP_002457359.1 30S ribosome-binding factor RbfA -
  QYE82_RS07465 infB 1582243..1584405 (-) 2163 WP_002457360.1 translation initiation factor IF-2 -
  QYE82_RS07470 - 1584410..1584727 (-) 318 WP_002446300.1 YlxQ family RNA-binding protein -
  QYE82_RS07475 - 1584727..1585011 (-) 285 WP_002446299.1 YlxR family protein -
  QYE82_RS07480 nusA 1585029..1586252 (-) 1224 WP_002446298.1 transcription termination factor NusA -
  QYE82_RS07485 rimP 1586274..1586741 (-) 468 WP_145368329.1 ribosome maturation factor RimP -
  QYE82_RS07490 - 1586921..1591231 (-) 4311 WP_145368666.1 PolC-type DNA polymerase III -
  QYE82_RS07495 - 1591481..1593184 (-) 1704 WP_145368334.1 proline--tRNA ligase -
  QYE82_RS07500 rseP 1593203..1594489 (-) 1287 WP_002457364.1 RIP metalloprotease RseP -
  QYE82_RS07505 - 1594722..1595504 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  QYE82_RS07510 - 1595508..1596278 (-) 771 WP_301560354.1 isoprenyl transferase -
  QYE82_RS07515 frr 1596499..1597053 (-) 555 WP_002446292.1 ribosome recycling factor -
  QYE82_RS07520 pyrH 1597070..1597792 (-) 723 WP_002439511.1 UMP kinase -
  QYE82_RS07525 tsf 1597933..1598811 (-) 879 WP_002446291.1 translation elongation factor Ts -
  QYE82_RS07530 rpsB 1598963..1599751 (-) 789 WP_002457366.1 30S ribosomal protein S2 -
  QYE82_RS07535 codY 1600108..1600881 (-) 774 WP_002446289.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  QYE82_RS07540 hslU 1600905..1602308 (-) 1404 WP_002457367.1 ATP-dependent protease ATPase subunit HslU -
  QYE82_RS07545 hslV 1602378..1602920 (-) 543 WP_002446288.1 ATP-dependent protease subunit HslV -
  QYE82_RS07550 xerC 1602924..1603814 (-) 891 WP_002457368.1 tyrosine recombinase XerC -
  QYE82_RS07555 trmFO 1604038..1605345 (-) 1308 WP_301560355.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  QYE82_RS07560 topA 1605370..1607439 (-) 2070 WP_002446285.1 type I DNA topoisomerase -
  QYE82_RS07565 dprA 1607619..1608494 (-) 876 WP_002457371.1 DNA-processing protein DprA Machinery gene
  QYE82_RS07570 - 1608819..1609034 (-) 216 Protein_1456 transposase -
  QYE82_RS07575 sucD 1609284..1610192 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  QYE82_RS07580 sucC 1610214..1611380 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  QYE82_RS07585 - 1611488..1612258 (-) 771 WP_002457372.1 ribonuclease HII -
  QYE82_RS07590 ylqF 1612263..1613126 (-) 864 WP_002457373.1 ribosome biogenesis GTPase YlqF -
  QYE82_RS07595 - 1613455..1616055 (+) 2601 WP_301560356.1 YfhO family protein -
  QYE82_RS07600 - 1616048..1618651 (+) 2604 WP_232156590.1 YfhO family protein -
  QYE82_RS07605 rplS 1618831..1619181 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  QYE82_RS07610 trmD 1619287..1620024 (-) 738 WP_020360159.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  QYE82_RS07615 rimM 1620024..1620527 (-) 504 WP_002457377.1 ribosome maturation factor RimM -
  QYE82_RS07620 rpsP 1620654..1620929 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  QYE82_RS07625 ffh 1621238..1622605 (-) 1368 WP_002457378.1 signal recognition particle protein -
  QYE82_RS07630 - 1622636..1622968 (-) 333 WP_002457379.1 putative DNA-binding protein -
  QYE82_RS07635 ftsY 1622970..1624196 (-) 1227 WP_002500808.1 signal recognition particle-docking protein FtsY -
  QYE82_RS07640 smc 1624193..1627762 (-) 3570 WP_301560357.1 chromosome segregation protein SMC -
  QYE82_RS07645 rnc 1627889..1628626 (-) 738 WP_002446271.1 ribonuclease III -
  QYE82_RS07650 - 1628741..1628974 (-) 234 WP_001830184.1 acyl carrier protein -
  QYE82_RS07655 fabG 1629200..1629934 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  QYE82_RS07660 fabD 1629927..1630856 (-) 930 WP_002457381.1 ACP S-malonyltransferase -
  QYE82_RS07665 plsX 1630858..1631835 (-) 978 WP_002457382.1 phosphate acyltransferase PlsX -
  QYE82_RS07670 fapR 1631837..1632397 (-) 561 WP_001830099.1 transcription factor FapR -
  QYE82_RS07675 recG 1632558..1634606 (-) 2049 WP_002457383.1 ATP-dependent DNA helicase RecG -
  QYE82_RS07680 fakA 1634810..1636468 (-) 1659 WP_002457384.1 fatty acid kinase catalytic subunit FakA -
  QYE82_RS07685 - 1636483..1636857 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  QYE82_RS07690 rpmB 1637215..1637403 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  QYE82_RS07695 - 1637487..1638122 (-) 636 WP_002446263.1 thiamine diphosphokinase -
  QYE82_RS07700 rpe 1638127..1638771 (-) 645 WP_002446262.1 ribulose-phosphate 3-epimerase -
  QYE82_RS07705 rsgA 1638772..1639647 (-) 876 WP_002457385.1 ribosome small subunit-dependent GTPase A -
  QYE82_RS07710 pknB 1639956..1641956 (-) 2001 WP_002457386.1 Stk1 family PASTA domain-containing Ser/Thr kinase -
  QYE82_RS07715 - 1641953..1642696 (-) 744 WP_301560358.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  QYE82_RS07720 rlmN 1642703..1643797 (-) 1095 WP_002457387.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -

Sequence

Protein


Download         Length: 291 a.a.        Molecular weight: 33946.10 Da        Isoelectric Point: 9.8284

>NTDB_id=852932 QYE82_RS07565 WP_002457371.1 1607619..1608494(-) (dprA) [Staphylococcus epidermidis strain CSMH-411EB]
MIQHTMLKLYWANFTTAQLHHLTRKYPGFLSENVFHQHDMIKRWLTERNSERLWNKYERFKKLKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSLAHQ
TALKYFLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPINKYKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILIDYLFM

Nucleotide


Download         Length: 876 bp        

>NTDB_id=852932 QYE82_RS07565 WP_002457371.1 1607619..1608494(-) (dprA) [Staphylococcus epidermidis strain CSMH-411EB]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACAGCACAACTTCATCATCTTACACGTAAATATCC
CGGCTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGACTAT
GGAACAAATATGAACGTTTCAAAAAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACG
ACATACTTCGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTCTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGTGGCGCAGATAGTTTAGCACATCAA
ACCGCACTTAAATACTTTTTACCAACTATTGGCGTACTTGGATTTGGACATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGAAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCCATAAATAAGTATAAATTTC
CTGAAAGAAACAGACTTATAAGTGGTCTGTCTAGAGGGGTTCTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATT
ACTATTGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGCAA
TTTACGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATCTTAATTGATTATCTATTTATGTAA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

57.639

98.969

0.57
  dprA Staphylococcus aureus N315

57.639

98.969

0.57