Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | QYE86_RS11350 | Genome accession | NZ_CP129360 |
| Coordinates | 2239029..2239424 (-) | Length | 131 a.a. |
| NCBI ID | WP_000932694.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CKMM-401M | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2200305..2239424 | 2239029..2239424 | within | 0 |
Gene organization within MGE regions
Location: 2200305..2239424
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QYE86_RS11135 | - | 2200305..2200799 (-) | 495 | WP_114579879.1 | IS30 family transposase | - |
| QYE86_RS11140 | - | 2200756..2201268 (-) | 513 | WP_000032528.1 | transposase | - |
| QYE86_RS11145 | - | 2201379..2201741 (-) | 363 | WP_000166622.1 | cystatin-like fold lipoprotein | - |
| QYE86_RS11150 | - | 2201788..2202381 (-) | 594 | WP_000850647.1 | hypothetical protein | - |
| QYE86_RS11155 | - | 2202387..2203415 (-) | 1029 | WP_000247483.1 | CHAP domain-containing protein | - |
| QYE86_RS11160 | - | 2203405..2205336 (-) | 1932 | WP_000824167.1 | CD3337/EF1877 family mobilome membrane protein | - |
| QYE86_RS11165 | - | 2205359..2205592 (-) | 234 | WP_000686779.1 | hypothetical protein | - |
| QYE86_RS11170 | - | 2205611..2205778 (-) | 168 | WP_001031397.1 | hypothetical protein | - |
| QYE86_RS11175 | - | 2205782..2207143 (-) | 1362 | WP_001251197.1 | FtsK/SpoIIIE domain-containing protein | - |
| QYE86_RS11180 | - | 2207148..2207480 (-) | 333 | WP_000696095.1 | hypothetical protein | - |
| QYE86_RS11185 | - | 2207477..2207707 (-) | 231 | WP_000990409.1 | hypothetical protein | - |
| QYE86_RS11190 | - | 2207711..2207929 (-) | 219 | WP_000217371.1 | hypothetical protein | - |
| QYE86_RS11195 | - | 2207941..2210436 (-) | 2496 | WP_000364354.1 | ATP-binding protein | - |
| QYE86_RS11200 | - | 2210471..2210860 (-) | 390 | WP_000358152.1 | TcpE family conjugal transfer membrane protein | - |
| QYE86_RS11205 | - | 2210866..2211126 (-) | 261 | WP_000369239.1 | TcpD family membrane protein | - |
| QYE86_RS11210 | - | 2211131..2212207 (-) | 1077 | WP_001225821.1 | conjugal transfer protein | - |
| QYE86_RS11215 | - | 2212368..2213444 (-) | 1077 | WP_000431198.1 | replication initiation factor domain-containing protein | - |
| QYE86_RS11220 | - | 2213624..2213926 (-) | 303 | WP_000398117.1 | hypothetical protein | - |
| QYE86_RS11225 | - | 2213930..2214265 (-) | 336 | WP_000312473.1 | DUF961 family protein | - |
| QYE86_RS11230 | - | 2214305..2214610 (-) | 306 | WP_000572394.1 | hypothetical protein | - |
| QYE86_RS11235 | - | 2214767..2215051 (-) | 285 | WP_000134552.1 | hypothetical protein | - |
| QYE86_RS11240 | - | 2215105..2215380 (-) | 276 | Protein_2182 | hypothetical protein | - |
| QYE86_RS11245 | - | 2215589..2216149 (-) | 561 | WP_044290681.1 | K(+)-transporting ATPase subunit C | - |
| QYE86_RS11250 | kdpB | 2216169..2218196 (-) | 2028 | WP_000546597.1 | potassium-transporting ATPase subunit KdpB | - |
| QYE86_RS11255 | kdpA | 2218215..2219891 (-) | 1677 | WP_044290682.1 | potassium-transporting ATPase subunit KdpA | - |
| QYE86_RS11260 | kdpF | 2219915..2220025 (-) | 111 | WP_001789641.1 | K(+)-transporting ATPase subunit F | - |
| QYE86_RS11265 | - | 2220163..2222820 (+) | 2658 | WP_044290683.1 | sensor histidine kinase KdpD | - |
| QYE86_RS11270 | - | 2222820..2223515 (+) | 696 | WP_001190841.1 | response regulator transcription factor | - |
| QYE86_RS11275 | - | 2223867..2225387 (-) | 1521 | WP_001178942.1 | DEAD/DEAH box helicase | - |
| QYE86_RS11280 | murF | 2225904..2227262 (-) | 1359 | WP_000611464.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| QYE86_RS11285 | - | 2227277..2228347 (-) | 1071 | WP_000159631.1 | D-alanine--D-alanine ligase | - |
| QYE86_RS11290 | - | 2228665..2229867 (+) | 1203 | WP_001109939.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| QYE86_RS11295 | - | 2230131..2230268 (-) | 138 | WP_000828354.1 | Lmo0850 family protein | - |
| QYE86_RS11300 | - | 2230396..2230605 (-) | 210 | WP_000581792.1 | heavy metal-associated domain-containing protein | - |
| QYE86_RS11305 | csoR | 2230617..2230910 (-) | 294 | WP_044290684.1 | copper-sensing transcriptional repressor CsoR | - |
| QYE86_RS11310 | cls | 2231076..2232560 (+) | 1485 | WP_000571549.1 | cardiolipin synthase | - |
| QYE86_RS11315 | - | 2232588..2233235 (+) | 648 | WP_001187629.1 | HD domain-containing protein | - |
| QYE86_RS11320 | yidC | 2233671..2234543 (-) | 873 | WP_000725802.1 | membrane protein insertase YidC | - |
| QYE86_RS11325 | thiE | 2234629..2235270 (-) | 642 | WP_044290685.1 | thiamine phosphate synthase | - |
| QYE86_RS11330 | thiM | 2235272..2236063 (-) | 792 | WP_001108489.1 | hydroxyethylthiazole kinase | - |
| QYE86_RS11335 | thiD | 2236047..2236877 (-) | 831 | WP_044290686.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| QYE86_RS11340 | tenA | 2236870..2237559 (-) | 690 | WP_000396067.1 | thiaminase II | - |
| QYE86_RS11345 | sceD | 2237945..2238640 (-) | 696 | WP_000752001.1 | lytic transglycosylase SceD | - |
| QYE86_RS11350 | ssb | 2239029..2239424 (-) | 396 | WP_000932694.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 15042.09 Da Isoelectric Point: 5.6824
>NTDB_id=852760 QYE86_RS11350 WP_000932694.1 2239029..2239424(-) (ssb) [Staphylococcus aureus strain CKMM-401M]
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
Nucleotide
Download Length: 396 bp
>NTDB_id=852760 QYE86_RS11350 WP_000932694.1 2239029..2239424(-) (ssb) [Staphylococcus aureus strain CKMM-401M]
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Staphylococcus aureus N315 |
100 |
100 |
1 |
| ssb | Staphylococcus aureus MW2 |
99.237 |
100 |
0.992 |