Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QTL84_RS12635 Genome accession   NZ_CP128559
Coordinates   2567019..2567333 (-) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus velezensis strain SH-1471     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2562019..2572333
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTL84_RS12590 sinI 2562700..2562873 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  QTL84_RS12595 sinR 2562907..2563242 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTL84_RS12600 tasA 2563290..2564075 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  QTL84_RS12605 sipW 2564140..2564724 (-) 585 WP_014418370.1 signal peptidase I SipW -
  QTL84_RS12610 tapA 2564696..2565367 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTL84_RS12615 - 2565626..2565955 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  QTL84_RS12620 - 2565996..2566175 (-) 180 WP_003153093.1 YqzE family protein -
  QTL84_RS12625 comGG 2566232..2566609 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTL84_RS12630 comGF 2566610..2567005 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  QTL84_RS12635 comGE 2567019..2567333 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTL84_RS12640 comGD 2567317..2567754 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTL84_RS12645 comGC 2567744..2568052 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  QTL84_RS12650 comGB 2568057..2569094 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTL84_RS12655 comGA 2569081..2570151 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  QTL84_RS12660 - 2570344..2571294 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=848990 QTL84_RS12635 WP_032863566.1 2567019..2567333(-) (comGE) [Bacillus velezensis strain SH-1471]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=848990 QTL84_RS12635 WP_032863566.1 2567019..2567333(-) (comGE) [Bacillus velezensis strain SH-1471]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49