Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QTL84_RS12590 Genome accession   NZ_CP128559
Coordinates   2562700..2562873 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SH-1471     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2557700..2567873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTL84_RS12575 gcvT 2558513..2559613 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  QTL84_RS12580 - 2560037..2561707 (+) 1671 WP_021494309.1 SNF2-related protein -
  QTL84_RS12585 - 2561729..2562523 (+) 795 WP_014418368.1 YqhG family protein -
  QTL84_RS12590 sinI 2562700..2562873 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  QTL84_RS12595 sinR 2562907..2563242 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTL84_RS12600 tasA 2563290..2564075 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  QTL84_RS12605 sipW 2564140..2564724 (-) 585 WP_014418370.1 signal peptidase I SipW -
  QTL84_RS12610 tapA 2564696..2565367 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTL84_RS12615 - 2565626..2565955 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  QTL84_RS12620 - 2565996..2566175 (-) 180 WP_003153093.1 YqzE family protein -
  QTL84_RS12625 comGG 2566232..2566609 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTL84_RS12630 comGF 2566610..2567005 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  QTL84_RS12635 comGE 2567019..2567333 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTL84_RS12640 comGD 2567317..2567754 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=848987 QTL84_RS12590 WP_014418369.1 2562700..2562873(+) (sinI) [Bacillus velezensis strain SH-1471]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=848987 QTL84_RS12590 WP_014418369.1 2562700..2562873(+) (sinI) [Bacillus velezensis strain SH-1471]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719