Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   QTN52_RS12800 Genome accession   NZ_CP128551
Coordinates   2603857..2604123 (-) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM123441     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2598857..2609123
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN52_RS12750 (QTN52_12750) sinR 2599020..2599355 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN52_RS12755 (QTN52_12755) tasA 2599403..2600188 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN52_RS12760 (QTN52_12760) sipW 2600253..2600837 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QTN52_RS12765 (QTN52_12765) tapA 2600809..2601480 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN52_RS12770 (QTN52_12770) - 2601739..2602068 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN52_RS12775 (QTN52_12775) - 2602109..2602288 (-) 180 WP_003153093.1 YqzE family protein -
  QTN52_RS12780 (QTN52_12780) comGG 2602345..2602722 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN52_RS12785 (QTN52_12785) comGF 2602723..2603118 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN52_RS12790 (QTN52_12790) comGE 2603132..2603446 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN52_RS12795 (QTN52_12795) comGD 2603430..2603867 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN52_RS12800 (QTN52_12800) comGC 2603857..2604123 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN52_RS12805 (QTN52_12805) comGB 2604170..2605207 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN52_RS12810 (QTN52_12810) comGA 2605194..2606264 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN52_RS12815 (QTN52_12815) - 2606457..2607407 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  QTN52_RS12820 (QTN52_12820) - 2607553..2608854 (+) 1302 WP_017418142.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=848858 QTN52_RS12800 WP_050496152.1 2603857..2604123(-) (comGC) [Bacillus velezensis strain SRCM123441]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=848858 QTN52_RS12800 WP_050496152.1 2603857..2604123(-) (comGC) [Bacillus velezensis strain SRCM123441]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602