Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QTN52_RS12790 Genome accession   NZ_CP128551
Coordinates   2603132..2603446 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain SRCM123441     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2598132..2608446
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN52_RS12745 (QTN52_12745) sinI 2598813..2598986 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  QTN52_RS12750 (QTN52_12750) sinR 2599020..2599355 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN52_RS12755 (QTN52_12755) tasA 2599403..2600188 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN52_RS12760 (QTN52_12760) sipW 2600253..2600837 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QTN52_RS12765 (QTN52_12765) tapA 2600809..2601480 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN52_RS12770 (QTN52_12770) - 2601739..2602068 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN52_RS12775 (QTN52_12775) - 2602109..2602288 (-) 180 WP_003153093.1 YqzE family protein -
  QTN52_RS12780 (QTN52_12780) comGG 2602345..2602722 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN52_RS12785 (QTN52_12785) comGF 2602723..2603118 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN52_RS12790 (QTN52_12790) comGE 2603132..2603446 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN52_RS12795 (QTN52_12795) comGD 2603430..2603867 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN52_RS12800 (QTN52_12800) comGC 2603857..2604123 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN52_RS12805 (QTN52_12805) comGB 2604170..2605207 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN52_RS12810 (QTN52_12810) comGA 2605194..2606264 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN52_RS12815 (QTN52_12815) - 2606457..2607407 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=848856 QTN52_RS12790 WP_017418140.1 2603132..2603446(-) (comGE) [Bacillus velezensis strain SRCM123441]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=848856 QTN52_RS12790 WP_017418140.1 2603132..2603446(-) (comGE) [Bacillus velezensis strain SRCM123441]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481