Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QTN52_RS12745 Genome accession   NZ_CP128551
Coordinates   2598813..2598986 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM123441     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2593813..2603986
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN52_RS12730 (QTN52_12730) gcvT 2594626..2595726 (-) 1101 WP_134986820.1 glycine cleavage system aminomethyltransferase GcvT -
  QTN52_RS12735 (QTN52_12735) - 2596150..2597820 (+) 1671 WP_017418135.1 SNF2-related protein -
  QTN52_RS12740 (QTN52_12740) - 2597842..2598636 (+) 795 WP_014305407.1 YqhG family protein -
  QTN52_RS12745 (QTN52_12745) sinI 2598813..2598986 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  QTN52_RS12750 (QTN52_12750) sinR 2599020..2599355 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN52_RS12755 (QTN52_12755) tasA 2599403..2600188 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN52_RS12760 (QTN52_12760) sipW 2600253..2600837 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QTN52_RS12765 (QTN52_12765) tapA 2600809..2601480 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN52_RS12770 (QTN52_12770) - 2601739..2602068 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN52_RS12775 (QTN52_12775) - 2602109..2602288 (-) 180 WP_003153093.1 YqzE family protein -
  QTN52_RS12780 (QTN52_12780) comGG 2602345..2602722 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN52_RS12785 (QTN52_12785) comGF 2602723..2603118 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN52_RS12790 (QTN52_12790) comGE 2603132..2603446 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN52_RS12795 (QTN52_12795) comGD 2603430..2603867 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=848853 QTN52_RS12745 WP_014418369.1 2598813..2598986(+) (sinI) [Bacillus velezensis strain SRCM123441]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=848853 QTN52_RS12745 WP_014418369.1 2598813..2598986(+) (sinI) [Bacillus velezensis strain SRCM123441]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719