Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   QTN52_RS01945 Genome accession   NZ_CP128551
Coordinates   389300..389419 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SRCM123441     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 384300..394419
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN52_RS01930 (QTN52_01930) - 385912..386595 (+) 684 WP_014416901.1 response regulator transcription factor -
  QTN52_RS01935 (QTN52_01935) - 386582..388015 (+) 1434 WP_134986378.1 HAMP domain-containing sensor histidine kinase -
  QTN52_RS01940 (QTN52_01940) rapC 388168..389316 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  QTN52_RS01945 (QTN52_01945) phrC 389300..389419 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QTN52_RS01950 (QTN52_01950) - 389569..389664 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  QTN52_RS01955 (QTN52_01955) - 389759..391123 (-) 1365 WP_053285479.1 aspartate kinase -
  QTN52_RS01960 (QTN52_01960) ceuB 391536..392489 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  QTN52_RS01965 (QTN52_01965) - 392479..393426 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  QTN52_RS01970 (QTN52_01970) - 393420..394178 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=848823 QTN52_RS01945 WP_003156334.1 389300..389419(+) (phrC) [Bacillus velezensis strain SRCM123441]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=848823 QTN52_RS01945 WP_003156334.1 389300..389419(+) (phrC) [Bacillus velezensis strain SRCM123441]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718