Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QTN49_RS07980 Genome accession   NZ_CP128504
Coordinates   1542741..1542914 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM123434     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1537741..1547914
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN49_RS07930 (QTN49_07930) comGD 1537860..1538297 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN49_RS07935 (QTN49_07935) comGE 1538281..1538595 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN49_RS07940 (QTN49_07940) comGF 1538609..1539004 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN49_RS07945 (QTN49_07945) comGG 1539005..1539382 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN49_RS07950 (QTN49_07950) - 1539439..1539618 (+) 180 WP_003153093.1 YqzE family protein -
  QTN49_RS07955 (QTN49_07955) - 1539659..1539988 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN49_RS07960 (QTN49_07960) tapA 1540247..1540918 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN49_RS07965 (QTN49_07965) sipW 1540890..1541474 (+) 585 WP_012117977.1 signal peptidase I SipW -
  QTN49_RS07970 (QTN49_07970) tasA 1541539..1542324 (+) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN49_RS07975 (QTN49_07975) sinR 1542372..1542707 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN49_RS07980 (QTN49_07980) sinI 1542741..1542914 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  QTN49_RS07985 (QTN49_07985) - 1543091..1543885 (-) 795 WP_014418368.1 YqhG family protein -
  QTN49_RS07990 (QTN49_07990) - 1543907..1545577 (-) 1671 WP_021494309.1 SNF2-related protein -
  QTN49_RS07995 (QTN49_07995) gcvT 1546001..1547101 (+) 1101 WP_271265647.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=848000 QTN49_RS07980 WP_014418369.1 1542741..1542914(-) (sinI) [Bacillus velezensis strain SRCM123434]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=848000 QTN49_RS07980 WP_014418369.1 1542741..1542914(-) (sinI) [Bacillus velezensis strain SRCM123434]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719