Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QTN49_RS07935 Genome accession   NZ_CP128504
Coordinates   1538281..1538595 (+) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain SRCM123434     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1533281..1543595
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN49_RS07910 (QTN49_07910) - 1534321..1535271 (+) 951 WP_071391609.1 magnesium transporter CorA family protein -
  QTN49_RS07915 (QTN49_07915) comGA 1535463..1536533 (+) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN49_RS07920 (QTN49_07920) comGB 1536520..1537557 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN49_RS07925 (QTN49_07925) comGC 1537604..1537870 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN49_RS07930 (QTN49_07930) comGD 1537860..1538297 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN49_RS07935 (QTN49_07935) comGE 1538281..1538595 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN49_RS07940 (QTN49_07940) comGF 1538609..1539004 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN49_RS07945 (QTN49_07945) comGG 1539005..1539382 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN49_RS07950 (QTN49_07950) - 1539439..1539618 (+) 180 WP_003153093.1 YqzE family protein -
  QTN49_RS07955 (QTN49_07955) - 1539659..1539988 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN49_RS07960 (QTN49_07960) tapA 1540247..1540918 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN49_RS07965 (QTN49_07965) sipW 1540890..1541474 (+) 585 WP_012117977.1 signal peptidase I SipW -
  QTN49_RS07970 (QTN49_07970) tasA 1541539..1542324 (+) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN49_RS07975 (QTN49_07975) sinR 1542372..1542707 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN49_RS07980 (QTN49_07980) sinI 1542741..1542914 (-) 174 WP_014418369.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=847997 QTN49_RS07935 WP_017418140.1 1538281..1538595(+) (comGE) [Bacillus velezensis strain SRCM123434]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=847997 QTN49_RS07935 WP_017418140.1 1538281..1538595(+) (comGE) [Bacillus velezensis strain SRCM123434]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481