Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   QTN49_RS07925 Genome accession   NZ_CP128504
Coordinates   1537604..1537870 (+) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM123434     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1532604..1542870
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN49_RS07905 (QTN49_07905) - 1532874..1534175 (-) 1302 WP_071181849.1 hemolysin family protein -
  QTN49_RS07910 (QTN49_07910) - 1534321..1535271 (+) 951 WP_071391609.1 magnesium transporter CorA family protein -
  QTN49_RS07915 (QTN49_07915) comGA 1535463..1536533 (+) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN49_RS07920 (QTN49_07920) comGB 1536520..1537557 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN49_RS07925 (QTN49_07925) comGC 1537604..1537870 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN49_RS07930 (QTN49_07930) comGD 1537860..1538297 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN49_RS07935 (QTN49_07935) comGE 1538281..1538595 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN49_RS07940 (QTN49_07940) comGF 1538609..1539004 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN49_RS07945 (QTN49_07945) comGG 1539005..1539382 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN49_RS07950 (QTN49_07950) - 1539439..1539618 (+) 180 WP_003153093.1 YqzE family protein -
  QTN49_RS07955 (QTN49_07955) - 1539659..1539988 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN49_RS07960 (QTN49_07960) tapA 1540247..1540918 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN49_RS07965 (QTN49_07965) sipW 1540890..1541474 (+) 585 WP_012117977.1 signal peptidase I SipW -
  QTN49_RS07970 (QTN49_07970) tasA 1541539..1542324 (+) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN49_RS07975 (QTN49_07975) sinR 1542372..1542707 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=847995 QTN49_RS07925 WP_050496152.1 1537604..1537870(+) (comGC) [Bacillus velezensis strain SRCM123434]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=847995 QTN49_RS07925 WP_050496152.1 1537604..1537870(+) (comGC) [Bacillus velezensis strain SRCM123434]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602