Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QTN49_RS04780 Genome accession   NZ_CP128504
Coordinates   942854..942994 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM123434     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 937854..947994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN49_RS04755 (QTN49_04755) - 938158..938556 (+) 399 WP_289414456.1 DUF1694 domain-containing protein -
  QTN49_RS04760 (QTN49_04760) - 938653..939204 (+) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  QTN49_RS04765 (QTN49_04765) - 939222..940688 (+) 1467 WP_106067969.1 nicotinate phosphoribosyltransferase -
  QTN49_RS04770 (QTN49_04770) - 940818..942041 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  QTN49_RS04775 (QTN49_04775) - 942048..942389 (-) 342 WP_014418765.1 hypothetical protein -
  QTN49_RS04780 (QTN49_04780) degQ 942854..942994 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QTN49_RS04785 (QTN49_04785) - 943125..944021 (+) 897 WP_017419425.1 polyprenyl synthetase family protein -
  QTN49_RS04790 (QTN49_04790) comX 944036..944212 (+) 177 WP_017419424.1 competence pheromone ComX -
  QTN49_RS04795 (QTN49_04795) comP 944231..946537 (+) 2307 WP_065180455.1 sensor histidine kinase Regulator
  QTN49_RS04800 (QTN49_04800) comA 946618..947262 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  QTN49_RS04805 (QTN49_04805) - 947284..947667 (+) 384 WP_104842774.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=847978 QTN49_RS04780 WP_003152043.1 942854..942994(+) (degQ) [Bacillus velezensis strain SRCM123434]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=847978 QTN49_RS04780 WP_003152043.1 942854..942994(+) (degQ) [Bacillus velezensis strain SRCM123434]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891