Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | QTN49_RS04780 | Genome accession | NZ_CP128504 |
| Coordinates | 942854..942994 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain SRCM123434 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 937854..947994
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTN49_RS04755 (QTN49_04755) | - | 938158..938556 (+) | 399 | WP_289414456.1 | DUF1694 domain-containing protein | - |
| QTN49_RS04760 (QTN49_04760) | - | 938653..939204 (+) | 552 | WP_025853916.1 | isochorismatase family cysteine hydrolase | - |
| QTN49_RS04765 (QTN49_04765) | - | 939222..940688 (+) | 1467 | WP_106067969.1 | nicotinate phosphoribosyltransferase | - |
| QTN49_RS04770 (QTN49_04770) | - | 940818..942041 (+) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| QTN49_RS04775 (QTN49_04775) | - | 942048..942389 (-) | 342 | WP_014418765.1 | hypothetical protein | - |
| QTN49_RS04780 (QTN49_04780) | degQ | 942854..942994 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| QTN49_RS04785 (QTN49_04785) | - | 943125..944021 (+) | 897 | WP_017419425.1 | polyprenyl synthetase family protein | - |
| QTN49_RS04790 (QTN49_04790) | comX | 944036..944212 (+) | 177 | WP_017419424.1 | competence pheromone ComX | - |
| QTN49_RS04795 (QTN49_04795) | comP | 944231..946537 (+) | 2307 | WP_065180455.1 | sensor histidine kinase | Regulator |
| QTN49_RS04800 (QTN49_04800) | comA | 946618..947262 (+) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| QTN49_RS04805 (QTN49_04805) | - | 947284..947667 (+) | 384 | WP_104842774.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=847978 QTN49_RS04780 WP_003152043.1 942854..942994(+) (degQ) [Bacillus velezensis strain SRCM123434]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=847978 QTN49_RS04780 WP_003152043.1 942854..942994(+) (degQ) [Bacillus velezensis strain SRCM123434]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |