Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QTN48_RS08575 Genome accession   NZ_CP128503
Coordinates   1620240..1620413 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM123422     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1615240..1625413
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN48_RS08525 (QTN48_08525) comGD 1615359..1615796 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN48_RS08530 (QTN48_08530) comGE 1615780..1616094 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN48_RS08535 (QTN48_08535) comGF 1616108..1616503 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN48_RS08540 (QTN48_08540) comGG 1616504..1616881 (+) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN48_RS08545 (QTN48_08545) - 1616938..1617117 (+) 180 WP_003153093.1 YqzE family protein -
  QTN48_RS08550 (QTN48_08550) - 1617158..1617487 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN48_RS08555 (QTN48_08555) tapA 1617746..1618417 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN48_RS08560 (QTN48_08560) sipW 1618389..1618973 (+) 585 WP_012117977.1 signal peptidase I SipW -
  QTN48_RS08565 (QTN48_08565) tasA 1619038..1619823 (+) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN48_RS08570 (QTN48_08570) sinR 1619871..1620206 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN48_RS08575 (QTN48_08575) sinI 1620240..1620413 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  QTN48_RS08580 (QTN48_08580) - 1620590..1621384 (-) 795 WP_014305407.1 YqhG family protein -
  QTN48_RS08585 (QTN48_08585) - 1621406..1623076 (-) 1671 WP_017418135.1 SNF2-related protein -
  QTN48_RS08590 (QTN48_08590) gcvT 1623500..1624600 (+) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=847924 QTN48_RS08575 WP_014418369.1 1620240..1620413(-) (sinI) [Bacillus velezensis strain SRCM123422]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=847924 QTN48_RS08575 WP_014418369.1 1620240..1620413(-) (sinI) [Bacillus velezensis strain SRCM123422]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719