Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QTN48_RS08530 Genome accession   NZ_CP128503
Coordinates   1615780..1616094 (+) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain SRCM123422     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1610780..1621094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN48_RS08505 (QTN48_08505) - 1611819..1612769 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  QTN48_RS08510 (QTN48_08510) comGA 1612962..1614032 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN48_RS08515 (QTN48_08515) comGB 1614019..1615056 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN48_RS08520 (QTN48_08520) comGC 1615103..1615369 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN48_RS08525 (QTN48_08525) comGD 1615359..1615796 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN48_RS08530 (QTN48_08530) comGE 1615780..1616094 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN48_RS08535 (QTN48_08535) comGF 1616108..1616503 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  QTN48_RS08540 (QTN48_08540) comGG 1616504..1616881 (+) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN48_RS08545 (QTN48_08545) - 1616938..1617117 (+) 180 WP_003153093.1 YqzE family protein -
  QTN48_RS08550 (QTN48_08550) - 1617158..1617487 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QTN48_RS08555 (QTN48_08555) tapA 1617746..1618417 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  QTN48_RS08560 (QTN48_08560) sipW 1618389..1618973 (+) 585 WP_012117977.1 signal peptidase I SipW -
  QTN48_RS08565 (QTN48_08565) tasA 1619038..1619823 (+) 786 WP_017418136.1 biofilm matrix protein TasA -
  QTN48_RS08570 (QTN48_08570) sinR 1619871..1620206 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QTN48_RS08575 (QTN48_08575) sinI 1620240..1620413 (-) 174 WP_014418369.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=847921 QTN48_RS08530 WP_017418140.1 1615780..1616094(+) (comGE) [Bacillus velezensis strain SRCM123422]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=847921 QTN48_RS08530 WP_017418140.1 1615780..1616094(+) (comGE) [Bacillus velezensis strain SRCM123422]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481