Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QTN46_RS12710 Genome accession   NZ_CP128501
Coordinates   2355370..2355807 (-) Length   145 a.a.
NCBI ID   WP_013352869.1    Uniprot ID   A0A9P1JIH3
Organism   Bacillus amyloliquefaciens strain SRCM123386     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2350370..2360807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN46_RS12660 (QTN46_12660) sinI 2350756..2350929 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  QTN46_RS12665 (QTN46_12665) sinR 2350963..2351298 (+) 336 WP_289393728.1 transcriptional regulator SinR Regulator
  QTN46_RS12670 (QTN46_12670) tasA 2351346..2352131 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  QTN46_RS12675 (QTN46_12675) sipW 2352196..2352780 (-) 585 WP_013352863.1 signal peptidase I SipW -
  QTN46_RS12680 (QTN46_12680) tapA 2352752..2353423 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  QTN46_RS12685 (QTN46_12685) - 2353681..2354010 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  QTN46_RS12690 (QTN46_12690) - 2354051..2354230 (-) 180 WP_013352866.1 YqzE family protein -
  QTN46_RS12695 (QTN46_12695) comGG 2354284..2354661 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN46_RS12700 (QTN46_12700) comGF 2354663..2355163 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  QTN46_RS12705 (QTN46_12705) comGE 2355072..2355386 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN46_RS12710 (QTN46_12710) comGD 2355370..2355807 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  QTN46_RS12715 (QTN46_12715) comGC 2355797..2356063 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  QTN46_RS12720 (QTN46_12720) comGB 2356110..2357147 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  QTN46_RS12725 (QTN46_12725) comGA 2357134..2358204 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  QTN46_RS12730 (QTN46_12730) - 2358398..2359348 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -
  QTN46_RS12735 (QTN46_12735) - 2359495..2360796 (+) 1302 WP_013352874.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16256.71 Da        Isoelectric Point: 9.7141

>NTDB_id=847850 QTN46_RS12710 WP_013352869.1 2355370..2355807(-) (comGD) [Bacillus amyloliquefaciens strain SRCM123386]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITIYLGSGNVHAERK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=847850 QTN46_RS12710 WP_013352869.1 2355370..2355807(-) (comGD) [Bacillus amyloliquefaciens strain SRCM123386]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACTCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACCCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGACA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACATTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTTGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAAAGCGCGGGATTCACTTATGAAATAACAATTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.115

95.862

0.538