Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QTN46_RS12660 | Genome accession | NZ_CP128501 |
| Coordinates | 2350756..2350929 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain SRCM123386 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2345756..2355929
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTN46_RS12645 (QTN46_12645) | gcvT | 2346581..2347681 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QTN46_RS12650 (QTN46_12650) | - | 2348105..2349775 (+) | 1671 | WP_014470658.1 | SNF2-related protein | - |
| QTN46_RS12655 (QTN46_12655) | - | 2349796..2350590 (+) | 795 | WP_013352859.1 | YqhG family protein | - |
| QTN46_RS12660 (QTN46_12660) | sinI | 2350756..2350929 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| QTN46_RS12665 (QTN46_12665) | sinR | 2350963..2351298 (+) | 336 | WP_289393728.1 | transcriptional regulator SinR | Regulator |
| QTN46_RS12670 (QTN46_12670) | tasA | 2351346..2352131 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| QTN46_RS12675 (QTN46_12675) | sipW | 2352196..2352780 (-) | 585 | WP_013352863.1 | signal peptidase I SipW | - |
| QTN46_RS12680 (QTN46_12680) | tapA | 2352752..2353423 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QTN46_RS12685 (QTN46_12685) | - | 2353681..2354010 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| QTN46_RS12690 (QTN46_12690) | - | 2354051..2354230 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| QTN46_RS12695 (QTN46_12695) | comGG | 2354284..2354661 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QTN46_RS12700 (QTN46_12700) | comGF | 2354663..2355163 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| QTN46_RS12705 (QTN46_12705) | comGE | 2355072..2355386 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| QTN46_RS12710 (QTN46_12710) | comGD | 2355370..2355807 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=847846 QTN46_RS12660 WP_013352860.1 2350756..2350929(+) (sinI) [Bacillus amyloliquefaciens strain SRCM123386]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=847846 QTN46_RS12660 WP_013352860.1 2350756..2350929(+) (sinI) [Bacillus amyloliquefaciens strain SRCM123386]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |