Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QTN46_RS12660 Genome accession   NZ_CP128501
Coordinates   2350756..2350929 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain SRCM123386     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2345756..2355929
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN46_RS12645 (QTN46_12645) gcvT 2346581..2347681 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  QTN46_RS12650 (QTN46_12650) - 2348105..2349775 (+) 1671 WP_014470658.1 SNF2-related protein -
  QTN46_RS12655 (QTN46_12655) - 2349796..2350590 (+) 795 WP_013352859.1 YqhG family protein -
  QTN46_RS12660 (QTN46_12660) sinI 2350756..2350929 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  QTN46_RS12665 (QTN46_12665) sinR 2350963..2351298 (+) 336 WP_289393728.1 transcriptional regulator SinR Regulator
  QTN46_RS12670 (QTN46_12670) tasA 2351346..2352131 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  QTN46_RS12675 (QTN46_12675) sipW 2352196..2352780 (-) 585 WP_013352863.1 signal peptidase I SipW -
  QTN46_RS12680 (QTN46_12680) tapA 2352752..2353423 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  QTN46_RS12685 (QTN46_12685) - 2353681..2354010 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  QTN46_RS12690 (QTN46_12690) - 2354051..2354230 (-) 180 WP_013352866.1 YqzE family protein -
  QTN46_RS12695 (QTN46_12695) comGG 2354284..2354661 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  QTN46_RS12700 (QTN46_12700) comGF 2354663..2355163 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  QTN46_RS12705 (QTN46_12705) comGE 2355072..2355386 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  QTN46_RS12710 (QTN46_12710) comGD 2355370..2355807 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=847846 QTN46_RS12660 WP_013352860.1 2350756..2350929(+) (sinI) [Bacillus amyloliquefaciens strain SRCM123386]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=847846 QTN46_RS12660 WP_013352860.1 2350756..2350929(+) (sinI) [Bacillus amyloliquefaciens strain SRCM123386]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684