Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QRA13_RS19975 Genome accession   NZ_CP128184
Coordinates   4028732..4028905 (-) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain YJ0-1 isolate soil     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 4023732..4033905
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRA13_RS19925 (QRA13_19925) comGD 4023851..4024288 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QRA13_RS19930 (QRA13_19930) comGE 4024272..4024586 (+) 315 WP_266121853.1 competence type IV pilus minor pilin ComGE -
  QRA13_RS19935 (QRA13_19935) comGF 4024495..4024995 (+) 501 WP_266121852.1 competence type IV pilus minor pilin ComGF -
  QRA13_RS19940 (QRA13_19940) comGG 4024996..4025373 (+) 378 WP_266121851.1 competence type IV pilus minor pilin ComGG Machinery gene
  QRA13_RS19945 (QRA13_19945) - 4025430..4025609 (+) 180 WP_003153093.1 YqzE family protein -
  QRA13_RS19950 (QRA13_19950) - 4025650..4025979 (-) 330 WP_038459175.1 DUF3889 domain-containing protein -
  QRA13_RS19955 (QRA13_19955) tapA 4026238..4026909 (+) 672 WP_266121850.1 amyloid fiber anchoring/assembly protein TapA -
  QRA13_RS19960 (QRA13_19960) - 4026881..4027465 (+) 585 WP_015240205.1 signal peptidase I SipW -
  QRA13_RS19965 (QRA13_19965) - 4027530..4028315 (+) 786 WP_044802563.1 biofilm matrix protein TasA -
  QRA13_RS19970 (QRA13_19970) sinR 4028363..4028698 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QRA13_RS19975 (QRA13_19975) sinI 4028732..4028905 (-) 174 WP_007612543.1 anti-repressor SinI Regulator
  QRA13_RS19980 (QRA13_19980) - 4029082..4029876 (-) 795 WP_221663819.1 YqhG family protein -
  QRA13_RS19985 (QRA13_19985) - 4029898..4031568 (-) 1671 WP_038459170.1 SNF2-related protein -
  QRA13_RS19990 (QRA13_19990) gcvT 4031992..4033092 (+) 1101 WP_045208234.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=846546 QRA13_RS19975 WP_007612543.1 4028732..4028905(-) (sinI) [Bacillus velezensis strain YJ0-1 isolate soil]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=846546 QRA13_RS19975 WP_007612543.1 4028732..4028905(-) (sinI) [Bacillus velezensis strain YJ0-1 isolate soil]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719