Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   QRA13_RS06635 Genome accession   NZ_CP128184
Coordinates   1432966..1433100 (-) Length   44 a.a.
NCBI ID   WP_286281087.1    Uniprot ID   -
Organism   Bacillus velezensis strain YJ0-1 isolate soil     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 1427966..1438100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRA13_RS06610 (QRA13_06610) - 1428267..1429253 (-) 987 WP_029325950.1 ABC transporter ATP-binding protein -
  QRA13_RS06615 (QRA13_06615) - 1429427..1430212 (-) 786 WP_029325951.1 DUF2268 domain-containing protein -
  QRA13_RS06620 (QRA13_06620) fabF 1430295..1431533 (-) 1239 WP_007610580.1 beta-ketoacyl-ACP synthase II -
  QRA13_RS06625 (QRA13_06625) - 1431556..1432494 (-) 939 WP_007409122.1 beta-ketoacyl-ACP synthase III -
  QRA13_RS06630 (QRA13_06630) - 1432662..1432880 (+) 219 WP_007409123.1 hypothetical protein -
  QRA13_RS06635 (QRA13_06635) comZ 1432966..1433100 (-) 135 WP_286281087.1 ComZ family protein Regulator
  QRA13_RS06640 (QRA13_06640) med 1433113..1434066 (-) 954 WP_007610578.1 BMP family ABC transporter substrate-binding protein Regulator
  QRA13_RS06645 (QRA13_06645) - 1434156..1434722 (-) 567 WP_224224176.1 hypothetical protein -
  QRA13_RS06650 (QRA13_06650) - 1434805..1435539 (-) 735 WP_007610576.1 hypothetical protein -
  QRA13_RS06655 (QRA13_06655) - 1435799..1435984 (+) 186 WP_003155069.1 YjzD family protein -
  QRA13_RS06660 (QRA13_06660) - 1436021..1436200 (-) 180 WP_003155070.1 YjzC family protein -
  QRA13_RS06665 (QRA13_06665) argF 1436276..1437247 (-) 972 WP_224224175.1 ornithine carbamoyltransferase -

Sequence

Protein


Download         Length: 44 a.a.        Molecular weight: 5181.11 Da        Isoelectric Point: 4.3110

>NTDB_id=846489 QRA13_RS06635 WP_286281087.1 1432966..1433100(-) (comZ) [Bacillus velezensis strain YJ0-1 isolate soil]
MQHEKSLEFMQIAMKYLPEAKAELEKSGIDLSMEMIQPFMDLFT

Nucleotide


Download         Length: 135 bp        

>NTDB_id=846489 QRA13_RS06635 WP_286281087.1 1432966..1433100(-) (comZ) [Bacillus velezensis strain YJ0-1 isolate soil]
ATGCAGCATGAAAAGTCTCTTGAATTTATGCAGATCGCGATGAAATACCTGCCGGAAGCAAAGGCGGAGCTTGAGAAATC
CGGCATAGATCTGTCTATGGAAATGATTCAGCCGTTTATGGACCTGTTTACATAG

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

86.364

100

0.864