Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   NSY31_RS02020 Genome accession   NZ_CP127834
Coordinates   402720..402839 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Ag109     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 397720..407839
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSY31_RS02005 (NSY31_02005) - 399332..400015 (+) 684 WP_063096183.1 response regulator transcription factor -
  NSY31_RS02010 (NSY31_02010) - 400002..401435 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  NSY31_RS02015 (NSY31_02015) rapC 401588..402736 (+) 1149 WP_098080978.1 Rap family tetratricopeptide repeat protein Regulator
  NSY31_RS02020 (NSY31_02020) phrC 402720..402839 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  NSY31_RS02025 (NSY31_02025) - 402988..403083 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  NSY31_RS02030 (NSY31_02030) - 403178..404542 (-) 1365 WP_080130839.1 aspartate kinase -
  NSY31_RS02035 (NSY31_02035) ceuB 404956..405909 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  NSY31_RS02040 (NSY31_02040) - 405899..406846 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  NSY31_RS02045 (NSY31_02045) - 406840..407598 (+) 759 WP_063096189.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=844498 NSY31_RS02020 WP_003156334.1 402720..402839(+) (phrC) [Bacillus velezensis strain Ag109]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=844498 NSY31_RS02020 WP_003156334.1 402720..402839(+) (phrC) [Bacillus velezensis strain Ag109]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718