Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   DBT50_RS00080 Genome accession   NZ_CP127382
Coordinates   18784..19356 (+) Length   190 a.a.
NCBI ID   WP_060779015.1    Uniprot ID   A0A0X8FFW9
Organism   Aerococcus tenax strain UMB3669     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1442..44348 18784..19356 within 0


Gene organization within MGE regions


Location: 1442..44348
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DBT50_RS00010 (DBT50_0000010) dnaN 1602..2753 (+) 1152 WP_064292854.1 DNA polymerase III subunit beta -
  DBT50_RS00015 (DBT50_0000015) - 3007..4341 (+) 1335 WP_111852463.1 FAD-binding oxidoreductase -
  DBT50_RS00020 (DBT50_0000020) yaaA 4686..4949 (+) 264 WP_111852464.1 S4 domain-containing protein YaaA -
  DBT50_RS00025 (DBT50_0000025) recF 4939..6057 (+) 1119 WP_111852465.1 DNA replication/repair protein RecF -
  DBT50_RS00030 (DBT50_0000030) gyrB 6068..8050 (+) 1983 WP_111853453.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  DBT50_RS00035 (DBT50_0000035) gyrA 8070..10730 (+) 2661 WP_111852467.1 DNA gyrase subunit A -
  DBT50_RS00040 (DBT50_0000040) - 11126..12031 (+) 906 WP_111852468.1 ABC transporter ATP-binding protein -
  DBT50_RS00045 (DBT50_0000045) - 12024..13328 (+) 1305 WP_111852469.1 ABC transporter permease -
  DBT50_RS00050 (DBT50_0000050) - 13458..13946 (+) 489 WP_181566127.1 GNAT family N-acetyltransferase -
  DBT50_RS00060 (DBT50_0000060) - 14378..15367 (-) 990 WP_111853455.1 asparaginase -
  DBT50_RS00065 (DBT50_0000065) - 15410..16828 (-) 1419 WP_111853456.1 YfcC family protein -
  DBT50_RS00070 (DBT50_09935) - 16821..18122 (-) 1302 WP_111852473.1 amidohydrolase -
  DBT50_RS00075 (DBT50_0000080) rpsF 18446..18748 (+) 303 WP_013669618.1 30S ribosomal protein S6 -
  DBT50_RS00080 (DBT50_0000085) ssb 18784..19356 (+) 573 WP_060779015.1 single-stranded DNA-binding protein Machinery gene
  DBT50_RS00085 (DBT50_0000090) rpsR 19384..19623 (+) 240 WP_013669454.1 30S ribosomal protein S18 -
  DBT50_RS00090 (DBT50_0000095) - 19844..20053 (+) 210 WP_111852474.1 helix-turn-helix transcriptional regulator -
  DBT50_RS00095 (DBT50_0000100) - 20037..20555 (+) 519 WP_181566128.1 DUF3278 domain-containing protein -
  DBT50_RS00100 (DBT50_0000105) - 23234..25264 (+) 2031 WP_111852476.1 DHH family phosphoesterase -
  DBT50_RS00105 (DBT50_0000110) - 25382..26092 (+) 711 WP_111852477.1 ATP-binding cassette domain-containing protein -
  DBT50_RS00110 (DBT50_0000115) - 26094..26867 (+) 774 WP_224785074.1 ABC transporter permease -
  DBT50_RS00115 (DBT50_0000120) - 26881..27660 (+) 780 WP_111852479.1 ABC transporter permease -
  DBT50_RS00120 (DBT50_0000125) rplI 27794..28246 (+) 453 WP_111852480.1 50S ribosomal protein L9 -
  DBT50_RS00125 (DBT50_0000130) dnaB 28396..29769 (+) 1374 WP_111852481.1 replicative DNA helicase -
  DBT50_RS00135 (DBT50_0000140) - 30403..30675 (-) 273 WP_111852482.1 type II toxin-antitoxin system YafQ family toxin -
  DBT50_RS00140 (DBT50_0000145) - 30668..30919 (-) 252 WP_060778044.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  DBT50_RS00145 (DBT50_0000150) - 31108..31287 (-) 180 WP_111852484.1 histidine kinase -
  DBT50_RS00150 (DBT50_0000155) - 31305..31472 (-) 168 WP_111852485.1 histidine kinase -
  DBT50_RS00155 (DBT50_0000160) - 31489..31668 (-) 180 WP_111852486.1 histidine kinase -
  DBT50_RS00160 (DBT50_0000165) - 31698..31958 (-) 261 WP_111853457.1 hypothetical protein -
  DBT50_RS00165 (DBT50_0000170) fucO 32730..33881 (+) 1152 WP_111852488.1 lactaldehyde reductase -
  DBT50_RS00170 (DBT50_0000175) - 34261..34692 (-) 432 WP_111852489.1 YrhK family protein -
  DBT50_RS00175 (DBT50_0000180) trpB 35207..36388 (-) 1182 WP_111852490.1 tryptophan synthase subunit beta -
  DBT50_RS00180 (DBT50_0000185) - 36737..37939 (-) 1203 WP_111852491.1 argininosuccinate synthase -
  DBT50_RS00185 (DBT50_0000190) - 38344..38892 (-) 549 WP_111852492.1 cysteine hydrolase family protein -
  DBT50_RS00190 (DBT50_0000195) - 39081..40028 (+) 948 WP_111852493.1 DNA/RNA non-specific endonuclease -
  DBT50_RS00195 (DBT50_0000200) - 40059..40754 (-) 696 WP_181566129.1 YoaK family protein -
  DBT50_RS00200 (DBT50_0000205) - 40919..41632 (+) 714 WP_111852495.1 glycosyltransferase family 2 protein -
  DBT50_RS00205 (DBT50_09940) - 42224..43030 (+) 807 WP_111852496.1 threonine/serine exporter ThrE family protein -
  DBT50_RS00210 (DBT50_09945) - 43023..43499 (+) 477 WP_060777500.1 threonine/serine exporter family protein -

Sequence


Protein


Download         Length: 190 a.a.        Molecular weight: 20886.50 Da        Isoelectric Point: 4.2964

>NTDB_id=843870 DBT50_RS00080 WP_060779015.1 18784..19356(+) (ssb) [Aerococcus tenax strain UMB3669]
MINNVVLVGRLTREVDLRYTQSGTAVANFTVACDRNYRNAQGETQTDFINCVMWRKAAENFAKFTRKGSLVGIEGNIQTR
NYENQQGQRVYVTEVLANNFSLLEPKSVTEQRPQASDNGNNFANPGNNFANDSFGSNQSFGGYNNQQDSPSMNDNSFGGS
NDPFAGGNNNPFPSNDNDGSINIADDDLPF

Nucleotide


Download         Length: 573 bp        

>NTDB_id=843870 DBT50_RS00080 WP_060779015.1 18784..19356(+) (ssb) [Aerococcus tenax strain UMB3669]
ATGATTAATAATGTCGTCTTAGTCGGCCGATTAACTCGGGAAGTTGATCTACGTTATACCCAAAGTGGAACTGCAGTAGC
CAACTTTACTGTAGCTTGTGACCGTAACTACCGCAATGCCCAAGGTGAAACTCAAACGGATTTCATCAATTGTGTGATGT
GGCGTAAAGCTGCTGAAAACTTTGCTAAATTTACACGAAAAGGTTCTTTGGTAGGGATTGAAGGCAATATTCAAACCCGT
AACTACGAAAACCAACAAGGCCAACGTGTTTATGTGACCGAAGTCTTAGCGAATAACTTTAGCTTACTGGAACCTAAGAG
TGTCACTGAACAACGCCCACAAGCCAGTGACAATGGCAATAACTTTGCCAACCCAGGCAATAATTTTGCTAATGACTCTT
TTGGCTCTAATCAAAGCTTTGGCGGCTATAATAATCAACAAGATTCCCCTTCAATGAATGATAACAGCTTTGGTGGATCC
AATGACCCATTTGCTGGTGGAAACAATAATCCTTTCCCATCAAATGATAATGACGGATCGATCAATATCGCTGATGATGA
TCTTCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0X8FFW9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

53.368

100

0.542

  ssbA Bacillus subtilis subsp. subtilis str. 168

48.187

100

0.489