Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QRX25_RS15305 Genome accession   NZ_CP127224
Coordinates   2965605..2965745 (-) Length   46 a.a.
NCBI ID   WP_289707641.1    Uniprot ID   -
Organism   Bacillus sp. L381     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2960605..2970745
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRX25_RS15280 (QRX25_15275) - 2960919..2961302 (-) 384 WP_212099079.1 hotdog fold thioesterase -
  QRX25_RS15285 (QRX25_15280) comA 2961324..2961968 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  QRX25_RS15290 (QRX25_15285) - 2962049..2964403 (-) 2355 Protein_2946 histidine kinase -
  QRX25_RS15295 (QRX25_15290) comX 2964381..2964551 (-) 171 WP_212099082.1 competence pheromone ComX -
  QRX25_RS15300 (QRX25_15295) comQ 2964566..2965474 (-) 909 WP_249199260.1 polyprenyl synthetase family protein Regulator
  QRX25_RS15305 (QRX25_15300) degQ 2965605..2965745 (-) 141 WP_289707641.1 degradation enzyme regulation protein DegQ Regulator
  QRX25_RS15310 (QRX25_15305) - 2966210..2966551 (+) 342 WP_115997039.1 hypothetical protein -
  QRX25_RS15315 (QRX25_15310) - 2966557..2967780 (-) 1224 WP_115997038.1 EAL and HDOD domain-containing protein -
  QRX25_RS15320 (QRX25_15315) - 2967910..2969376 (-) 1467 WP_115997037.1 nicotinate phosphoribosyltransferase -
  QRX25_RS15325 (QRX25_15320) - 2969394..2969945 (-) 552 WP_212099085.1 isochorismatase family cysteine hydrolase -
  QRX25_RS15330 (QRX25_15325) - 2970026..2970421 (-) 396 WP_013353403.1 DUF1694 domain-containing protein -
  QRX25_RS15335 (QRX25_15330) - 2970487..2970735 (-) 249 WP_013353404.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5531.43 Da        Isoelectric Point: 9.8152

>NTDB_id=842836 QRX25_RS15305 WP_289707641.1 2965605..2965745(-) (degQ) [Bacillus sp. L381]
MKKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=842836 QRX25_RS15305 WP_289707641.1 2965605..2965745(-) (degQ) [Bacillus sp. L381]
GTGAAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891