Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QRX25_RS11970 Genome accession   NZ_CP127224
Coordinates   2360693..2361007 (-) Length   104 a.a.
NCBI ID   WP_065981881.1    Uniprot ID   -
Organism   Bacillus sp. L381     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2355693..2366007
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRX25_RS11925 (QRX25_11920) sinI 2356374..2356547 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  QRX25_RS11930 (QRX25_11925) sinR 2356581..2356916 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  QRX25_RS11935 (QRX25_11930) tasA 2356964..2357749 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  QRX25_RS11940 (QRX25_11935) sipW 2357814..2358398 (-) 585 WP_212098460.1 signal peptidase I SipW -
  QRX25_RS11945 (QRX25_11940) tapA 2358370..2359041 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  QRX25_RS11950 (QRX25_11945) - 2359299..2359628 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  QRX25_RS11955 (QRX25_11950) - 2359669..2359848 (-) 180 WP_016938971.1 YqzE family protein -
  QRX25_RS11960 (QRX25_11955) comGG 2359905..2360282 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  QRX25_RS11965 (QRX25_11960) comGF 2360284..2360784 (-) 501 WP_249199234.1 competence type IV pilus minor pilin ComGF -
  QRX25_RS11970 (QRX25_11965) comGE 2360693..2361007 (-) 315 WP_065981881.1 competence type IV pilus minor pilin ComGE Machinery gene
  QRX25_RS11975 (QRX25_11970) comGD 2360991..2361428 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene
  QRX25_RS11980 (QRX25_11975) comGC 2361418..2361726 (-) 309 WP_115997634.1 competence type IV pilus major pilin ComGC Machinery gene
  QRX25_RS11985 (QRX25_11980) comGB 2361731..2362768 (-) 1038 WP_212098466.1 competence type IV pilus assembly protein ComGB Machinery gene
  QRX25_RS11990 (QRX25_11985) comGA 2362755..2363825 (-) 1071 WP_115997636.1 competence type IV pilus ATPase ComGA Machinery gene
  QRX25_RS11995 (QRX25_11990) - 2364018..2364968 (-) 951 WP_212098468.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11881.87 Da        Isoelectric Point: 7.1308

>NTDB_id=842817 QRX25_RS11970 WP_065981881.1 2360693..2361007(-) (comGE) [Bacillus sp. L381]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEERQEAYQLLHKHISAYMMSGKKQPSPGVTWKEDGDYYK
VCAAVRGEKEMCLSILKTEWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=842817 QRX25_RS11970 WP_065981881.1 2360693..2361007(-) (comGE) [Bacillus sp. L381]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACGCCAGGAAGCGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCGGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGAATGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

45.217

100

0.5