Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QRX25_RS11925 Genome accession   NZ_CP127224
Coordinates   2356374..2356547 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus sp. L381     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2351374..2361547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRX25_RS11910 (QRX25_11905) gcvT 2352185..2353285 (-) 1101 WP_115997629.1 glycine cleavage system aminomethyltransferase GcvT -
  QRX25_RS11915 (QRX25_11910) - 2353709..2355379 (+) 1671 WP_065981874.1 SNF2-related protein -
  QRX25_RS11920 (QRX25_11915) - 2355400..2356194 (+) 795 WP_065981875.1 YqhG family protein -
  QRX25_RS11925 (QRX25_11920) sinI 2356374..2356547 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  QRX25_RS11930 (QRX25_11925) sinR 2356581..2356916 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  QRX25_RS11935 (QRX25_11930) tasA 2356964..2357749 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  QRX25_RS11940 (QRX25_11935) sipW 2357814..2358398 (-) 585 WP_212098460.1 signal peptidase I SipW -
  QRX25_RS11945 (QRX25_11940) tapA 2358370..2359041 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  QRX25_RS11950 (QRX25_11945) - 2359299..2359628 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  QRX25_RS11955 (QRX25_11950) - 2359669..2359848 (-) 180 WP_016938971.1 YqzE family protein -
  QRX25_RS11960 (QRX25_11955) comGG 2359905..2360282 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  QRX25_RS11965 (QRX25_11960) comGF 2360284..2360784 (-) 501 WP_249199234.1 competence type IV pilus minor pilin ComGF -
  QRX25_RS11970 (QRX25_11965) comGE 2360693..2361007 (-) 315 WP_065981881.1 competence type IV pilus minor pilin ComGE Machinery gene
  QRX25_RS11975 (QRX25_11970) comGD 2360991..2361428 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=842814 QRX25_RS11925 WP_013352860.1 2356374..2356547(+) (sinI) [Bacillus sp. L381]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=842814 QRX25_RS11925 WP_013352860.1 2356374..2356547(+) (sinI) [Bacillus sp. L381]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684