Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGA   Type   Machinery gene
Locus tag   LLUL007_RS11290 Genome accession   NZ_CP126569
Coordinates   2161392..2161583 (-) Length   63 a.a.
NCBI ID   WP_014573341.1    Uniprot ID   A0A896TDC6
Organism   Lactococcus cremoris strain UL007     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2152352..2160453 2161392..2161583 flank 939
IS/Tn 2160520..2161410 2161392..2161583 flank -18


Gene organization within MGE regions


Location: 2152352..2161583
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUL007_RS11230 (LLUL007_11295) - 2153812..2154621 (-) 810 WP_396425802.1 metal ABC transporter permease -
  LLUL007_RS11235 (LLUL007_11300) - 2154614..2155351 (-) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LLUL007_RS11240 (LLUL007_11305) - 2155530..2156372 (-) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLUL007_RS11245 (LLUL007_11310) - 2156369..2156806 (-) 438 WP_396425803.1 zinc-dependent MarR family transcriptional regulator -
  LLUL007_RS11250 (LLUL007_11315) comGG 2156886..2157185 (-) 300 WP_396425805.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUL007_RS11255 (LLUL007_11320) comGF 2157209..2157655 (-) 447 WP_011836043.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUL007_RS11260 (LLUL007_11325) comGE 2157618..2157914 (-) 297 WP_021164977.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUL007_RS11265 (LLUL007_11330) comGD 2157886..2158074 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLUL007_RS11270 (LLUL007_11335) comGC 2158276..2158626 (-) 351 WP_050574401.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUL007_RS11275 (LLUL007_11340) comGB 2158671..2159696 (-) 1026 WP_050574400.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUL007_RS11280 (LLUL007_11345) - 2159596..2160417 (-) 822 Protein_2195 ATPase, T2SS/T4P/T4SS family -
  LLUL007_RS11285 (LLUL007_11350) - 2160520..2161410 (+) 891 WP_011675620.1 IS982-like element IS982B family transposase -
  LLUL007_RS11290 (LLUL007_11355) comGA 2161392..2161583 (-) 192 WP_014573341.1 hypothetical protein Machinery gene

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7255.51 Da        Isoelectric Point: 4.3901

>NTDB_id=838752 LLUL007_RS11290 WP_014573341.1 2161392..2161583(-) (comGA) [Lactococcus cremoris strain UL007]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLAMT

Nucleotide


Download         Length: 192 bp        

>NTDB_id=838752 LLUL007_RS11290 WP_014573341.1 2161392..2161583(-) (comGA) [Lactococcus cremoris strain UL007]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGCCATGACTTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Lactococcus lactis subsp. cremoris KW2

96.226

84.127

0.81