NTDB

Overview

Name	comGF	Type	Machinery gene
Locus tag	LLUL007_RS11255	Genome accession	NZ_CP126569
Coordinates	2157209..2157655 (-)	Length	148 a.a.
NCBI ID	WP_011836043.1	Uniprot ID	A0A1V0PET3
Organism	Lactococcus cremoris strain UL007
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2152352..2160453	2157209..2157655	within	0

Gene organization within MGE regions

Location: 2152352..2160453

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUL007_RS11230 (LLUL007_11295)	-	2153812..2154621 (-)	810	WP_396425802.1	metal ABC transporter permease	-
LLUL007_RS11235 (LLUL007_11300)	-	2154614..2155351 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUL007_RS11240 (LLUL007_11305)	-	2155530..2156372 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUL007_RS11245 (LLUL007_11310)	-	2156369..2156806 (-)	438	WP_396425803.1	zinc-dependent MarR family transcriptional regulator	-
LLUL007_RS11250 (LLUL007_11315)	comGG	2156886..2157185 (-)	300	WP_396425805.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUL007_RS11255 (LLUL007_11320)	comGF	2157209..2157655 (-)	447	WP_011836043.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUL007_RS11260 (LLUL007_11325)	comGE	2157618..2157914 (-)	297	WP_021164977.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUL007_RS11265 (LLUL007_11330)	comGD	2157886..2158074 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUL007_RS11270 (LLUL007_11335)	comGC	2158276..2158626 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUL007_RS11275 (LLUL007_11340)	comGB	2158671..2159696 (-)	1026	WP_050574400.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUL007_RS11280 (LLUL007_11345)	-	2159596..2160417 (-)	822	Protein_2195	ATPase, T2SS/T4P/T4SS family	-

Sequence

Protein

Download Length: 148 a.a. Molecular weight: 17102.82 Da Isoelectric Point: 8.2376

                                >NTDB_id=838747 LLUL007_RS11255 WP_011836043.1 2157209..2157655(-) (comGF) [Lactococcus cremoris strain UL007]

MERKFCDLKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGAKLDNVNQNFL

YVTKDKKLRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK

Nucleotide

Download Length: 447 bp

                                >NTDB_id=838747 LLUL007_RS11255 WP_011836043.1 2157209..2157655(-) (comGF) [Lactococcus cremoris strain UL007]

ATGGAAAGGAAATTTTGCGACTTGAAGCTCAAAATTAGGGCATTTACTTTACTTGAATGTCTCGTAGCACTTTTGGCAAT

TTCTGGTTCAGTGCTAGTCATCTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGA

AAGATTGGCAAATATTTTGTGAACAAATGCGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTG

TATGTGACCAAAGATAAGAAGTTACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATA

CCAACCGATGCTTTATGATTTAAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATA

ATGGAGGTGAGCGAGTATTTATTTATCGATTTACTGATACAAAGTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(45-137)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF	Lactococcus lactis subsp. cremoris KW2	99.291	95.27	0.946
comYF	Streptococcus mutans UA140	44.681	95.27	0.426
comYF	Streptococcus mutans UA159	43.972	95.27	0.419
comGF/cglF	Streptococcus mitis SK321	39.286	94.595	0.372
comGF/cglF	Streptococcus mitis NCTC 12261	39.286	94.595	0.372

Detailed information NTG0838747