Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   QMK35_RS09500 Genome accession   NZ_CP126540
Coordinates   1976563..1977126 (-) Length   187 a.a.
NCBI ID   WP_107384866.1    Uniprot ID   -
Organism   Staphylococcus cohnii strain SDAQ-1     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1935761..1976191 1976563..1977126 flank 372


Gene organization within MGE regions


Location: 1935761..1977126
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMK35_RS09220 (QMK35_09220) - 1935761..1936699 (-) 939 WP_285159479.1 hypothetical protein -
  QMK35_RS09225 (QMK35_09225) - 1936853..1938271 (-) 1419 WP_285159480.1 N-acetylmuramoyl-L-alanine amidase -
  QMK35_RS09230 (QMK35_09230) - 1938243..1938716 (-) 474 WP_285159481.1 phage holin -
  QMK35_RS09235 (QMK35_09235) - 1938832..1939227 (-) 396 WP_285159483.1 hypothetical protein -
  QMK35_RS09240 (QMK35_09240) - 1939211..1939651 (-) 441 WP_285159484.1 hypothetical protein -
  QMK35_RS09245 (QMK35_09245) - 1939689..1939838 (-) 150 WP_285159485.1 hypothetical protein -
  QMK35_RS09250 (QMK35_09250) - 1939831..1942233 (-) 2403 WP_285159486.1 phage tail spike protein -
  QMK35_RS09255 (QMK35_09255) - 1942287..1944434 (-) 2148 WP_285159553.1 hypothetical protein -
  QMK35_RS09260 (QMK35_09260) - 1944443..1945270 (-) 828 WP_285159554.1 phage tail domain-containing protein -
  QMK35_RS09265 (QMK35_09265) - 1945286..1951264 (-) 5979 WP_285159555.1 peptidoglycan DD-metalloendopeptidase family protein -
  QMK35_RS09270 (QMK35_09270) gpG 1951463..1951999 (-) 537 WP_107504739.1 phage tail assembly chaperone G -
  QMK35_RS09275 (QMK35_09275) - 1952075..1952674 (-) 600 WP_285159556.1 major tail protein -
  QMK35_RS09280 (QMK35_09280) - 1952678..1953091 (-) 414 WP_285159492.1 hypothetical protein -
  QMK35_RS09285 (QMK35_09285) - 1953084..1953503 (-) 420 WP_107504735.1 HK97-gp10 family putative phage morphogenesis protein -
  QMK35_RS09290 (QMK35_09290) - 1953500..1953823 (-) 324 WP_285159493.1 phage head closure protein -
  QMK35_RS09295 (QMK35_09295) - 1953793..1954122 (-) 330 WP_285159557.1 head-tail connector protein -
  QMK35_RS09300 (QMK35_09300) - 1954132..1954299 (-) 168 WP_285159558.1 hypothetical protein -
  QMK35_RS09305 (QMK35_09305) - 1954314..1955642 (-) 1329 WP_285159559.1 phage major capsid protein -
  QMK35_RS09310 (QMK35_09310) - 1955693..1956250 (-) 558 WP_285159560.1 HK97 family phage prohead protease -
  QMK35_RS09315 (QMK35_09315) - 1956237..1957475 (-) 1239 WP_285159561.1 phage portal protein -
  QMK35_RS09320 (QMK35_09320) - 1957475..1957651 (-) 177 WP_285159499.1 hypothetical protein -
  QMK35_RS09325 (QMK35_09325) - 1957665..1959413 (-) 1749 WP_285159562.1 terminase large subunit -
  QMK35_RS09330 (QMK35_09330) - 1959406..1959876 (-) 471 WP_285159563.1 phage terminase small subunit P27 family -
  QMK35_RS09335 (QMK35_09335) - 1960001..1960372 (-) 372 WP_285159503.1 HNH endonuclease -
  QMK35_RS09340 (QMK35_09340) - 1961045..1961458 (-) 414 WP_210139481.1 hypothetical protein -
  QMK35_RS09345 (QMK35_09345) - 1961472..1961780 (-) 309 WP_285159564.1 hypothetical protein -
  QMK35_RS09350 (QMK35_09350) - 1961789..1962139 (-) 351 WP_285159565.1 hypothetical protein -
  QMK35_RS09355 (QMK35_09355) - 1962136..1962267 (-) 132 WP_285159566.1 transcriptional regulator -
  QMK35_RS09360 (QMK35_09360) - 1962446..1962721 (-) 276 WP_349017140.1 DUF1381 domain-containing protein -
  QMK35_RS09365 (QMK35_09365) - 1962767..1963078 (-) 312 WP_285159568.1 MazG-like family protein -
  QMK35_RS09370 (QMK35_09370) - 1963071..1963289 (-) 219 WP_046208763.1 hypothetical protein -
  QMK35_RS09375 (QMK35_09375) - 1963291..1963500 (-) 210 WP_285159569.1 hypothetical protein -
  QMK35_RS09380 (QMK35_09380) - 1963502..1963777 (-) 276 WP_285159570.1 hypothetical protein -
  QMK35_RS09385 (QMK35_09385) - 1963977..1964282 (-) 306 WP_285159513.1 DUF1140 family protein -
  QMK35_RS09390 (QMK35_09390) - 1964283..1964975 (-) 693 WP_285159571.1 DUF3310 domain-containing protein -
  QMK35_RS09395 (QMK35_09395) - 1964976..1965194 (-) 219 WP_285159572.1 hypothetical protein -
  QMK35_RS09400 (QMK35_09400) - 1965206..1965607 (-) 402 WP_285159573.1 hypothetical protein -
  QMK35_RS09405 (QMK35_09405) - 1965609..1965797 (-) 189 WP_107504996.1 hypothetical protein -
  QMK35_RS09410 (QMK35_09410) - 1965790..1966110 (-) 321 WP_285159574.1 VRR-NUC domain-containing protein -
  QMK35_RS09415 (QMK35_09415) - 1966401..1968701 (-) 2301 WP_285159575.1 phage/plasmid primase, P4 family -
  QMK35_RS09420 (QMK35_09420) - 1968722..1969222 (-) 501 WP_285159576.1 DUF669 domain-containing protein -
  QMK35_RS09425 (QMK35_09425) - 1969225..1969923 (-) 699 WP_285159577.1 hypothetical protein -
  QMK35_RS09430 (QMK35_09430) - 1969930..1971273 (-) 1344 WP_285159578.1 DEAD/DEAH box helicase -
  QMK35_RS09435 (QMK35_09435) - 1971257..1971961 (-) 705 WP_285159579.1 AAA family ATPase -
  QMK35_RS09440 (QMK35_09440) - 1971951..1972175 (-) 225 WP_210139088.1 DUF2483 family protein -
  QMK35_RS09445 (QMK35_09445) - 1972172..1972435 (-) 264 WP_285159580.1 DUF1108 family protein -
  QMK35_RS09450 (QMK35_09450) - 1972502..1972678 (-) 177 WP_204174229.1 hypothetical protein -
  QMK35_RS09455 (QMK35_09455) - 1972680..1972886 (-) 207 WP_285159581.1 hypothetical protein -
  QMK35_RS09460 (QMK35_09460) - 1972899..1973108 (-) 210 WP_285159582.1 hypothetical protein -
  QMK35_RS09465 (QMK35_09465) - 1973136..1973366 (-) 231 WP_210129027.1 helix-turn-helix domain-containing protein -
  QMK35_RS09470 (QMK35_09470) - 1973531..1973866 (+) 336 WP_285159583.1 helix-turn-helix domain-containing protein -
  QMK35_RS09475 (QMK35_09475) - 1973878..1974342 (+) 465 WP_285159584.1 ImmA/IrrE family metallo-endopeptidase -
  QMK35_RS09480 (QMK35_09480) - 1974430..1975080 (+) 651 WP_285159585.1 DUF4352 domain-containing protein -
  QMK35_RS09485 (QMK35_09485) - 1975142..1976191 (+) 1050 WP_285159586.1 site-specific integrase -
  QMK35_RS09500 (QMK35_09500) comK/comK1 1976563..1977126 (-) 564 WP_107384866.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 187 a.a.        Molecular weight: 22059.33 Da        Isoelectric Point: 9.5680

>NTDB_id=838685 QMK35_RS09500 WP_107384866.1 1976563..1977126(-) (comK/comK1) [Staphylococcus cohnii strain SDAQ-1]
MIQPYIIKKGDMTLQPCHLPVGQYEGTRVLRYKEDESTIKERTHKIIDRSCRFYGSSYVFKKEDTIRITGISSKPPILFT
PLFPTYFFPTHSDRKTQNTWINIHYVQSIRSLKDKKCRVNFVDNQSIVVNISAHSMQHQYLNGIYYYYMMDRAARVATFD
PESPIDYTKPQLNIYEALAKYSLFESK

Nucleotide


Download         Length: 564 bp        

>NTDB_id=838685 QMK35_RS09500 WP_107384866.1 1976563..1977126(-) (comK/comK1) [Staphylococcus cohnii strain SDAQ-1]
ATGATACAACCGTATATTATTAAAAAAGGTGATATGACATTACAACCGTGCCATTTGCCTGTTGGCCAATATGAAGGTAC
ACGAGTACTAAGATATAAAGAAGACGAAAGTACGATAAAAGAACGCACCCACAAAATCATTGATCGTTCTTGTAGATTTT
ATGGTAGTAGCTATGTTTTTAAAAAAGAGGACACAATTCGTATTACAGGCATTAGTAGCAAGCCCCCAATTTTATTTACT
CCATTATTTCCCACTTATTTTTTCCCGACACATTCTGATAGAAAAACACAAAATACATGGATCAATATCCATTATGTTCA
AAGTATTAGATCACTAAAAGATAAAAAATGTAGAGTGAACTTTGTTGATAATCAATCTATCGTTGTGAATATCTCAGCTC
ATAGCATGCAACATCAATATTTAAATGGCATTTATTATTATTATATGATGGATAGAGCAGCAAGAGTTGCCACTTTTGAT
CCAGAGTCTCCCATAGATTACACAAAACCTCAATTAAATATATATGAAGCACTCGCTAAATATTCTTTATTTGAAAGTAA
ATAG

Domains


Predicted by InterproScan.

(4-152)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

53.005

97.861

0.519

  comK/comK1 Staphylococcus aureus N315

53.005

97.861

0.519