Detailed information    

insolico Bioinformatically predicted

Overview


Name   ccrA   Type   Machinery gene
Locus tag   QMK35_RS00275 Genome accession   NZ_CP126540
Coordinates   59891..61240 (-) Length   449 a.a.
NCBI ID   WP_210124230.1    Uniprot ID   -
Organism   Staphylococcus cohnii strain SDAQ-1     
Function   promote SCCmec transfer (predicted from homology)   
Homologous recombination

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
SCCmec 39155..105398 59891..61240 within 0


Gene organization within MGE regions


Location: 39155..105398
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMK35_RS00170 (QMK35_00170) mecA 39155..41164 (-) 2010 WP_063852655.1 PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecA -
  QMK35_RS00175 (QMK35_00175) mecR1 41261..43018 (+) 1758 WP_000952923.1 beta-lactam sensor/signal transducer MecR1 -
  QMK35_RS00180 (QMK35_00180) mecI 43018..43389 (+) 372 WP_025904161.1 mecA-type methicillin resistance repressor MecI -
  QMK35_RS00185 (QMK35_00185) psm-mec 43474..43542 (-) 69 WP_014532405.1 phenol-soluble modulin PSM-mec -
  QMK35_RS00190 (QMK35_00190) - 43862..45010 (+) 1149 WP_075773656.1 ROK family transcriptional regulator -
  QMK35_RS00195 (QMK35_00195) cstB 45124..46458 (-) 1335 Protein_36 persulfide dioxygenase-sulfurtransferase CstB -
  QMK35_RS00200 (QMK35_00200) - 46491..47555 (-) 1065 WP_000438836.1 DsrE/DsrF/DrsH-like family protein -
  QMK35_RS00205 (QMK35_00205) cstR 47691..47951 (+) 261 WP_000220507.1 persulfide-sensing transcriptional repressor CstR -
  QMK35_RS00210 (QMK35_00210) - 47951..48589 (+) 639 Protein_39 sulfite exporter TauE/SafE family protein -
  QMK35_RS00215 (QMK35_00215) - 48863..49480 (-) 618 WP_000562107.1 CadD family cadmium resistance transporter -
  QMK35_RS00220 (QMK35_00220) - 49561..51975 (-) 2415 WP_198054454.1 heavy metal translocating P-type ATPase -
  QMK35_RS00225 (QMK35_00225) - 51968..52333 (-) 366 WP_000159127.1 metalloregulator ArsR/SmtB family transcription factor -
  QMK35_RS00230 (QMK35_00230) - 52571..52948 (-) 378 WP_001041908.1 DUF6262 family protein -
  QMK35_RS00235 (QMK35_00235) - 52955..54847 (-) 1893 WP_002485298.1 site-specific integrase -
  QMK35_RS00240 (QMK35_00240) - 55042..55365 (-) 324 WP_000088091.1 JAB domain-containing protein -
  QMK35_RS00245 (QMK35_00245) - 55358..55564 (-) 207 WP_001077283.1 hypothetical protein -
  QMK35_RS00250 (QMK35_00250) - 55566..56087 (-) 522 WP_000836008.1 DUF1643 domain-containing protein -
  QMK35_RS00255 (QMK35_00255) - 56106..56417 (-) 312 WP_000833212.1 DUF960 family protein -
  QMK35_RS00260 (QMK35_00260) - 56502..56852 (-) 351 WP_000171449.1 SAUGI family uracil-DNA glycosylase inhibitor -
  QMK35_RS00265 (QMK35_00265) - 57419..58153 (-) 735 WP_044291471.1 glucose 1-dehydrogenase -
  QMK35_RS00270 (QMK35_00270) ccrB 58241..59869 (-) 1629 WP_198054455.1 cassette chromosome recombinase CcrB Machinery gene
  QMK35_RS00275 (QMK35_00275) ccrA 59891..61240 (-) 1350 WP_210124230.1 cassette chromosome recombinase CcrA Machinery gene
  QMK35_RS00280 (QMK35_00280) - 61429..61707 (-) 279 WP_070373498.1 hypothetical protein -
  QMK35_RS00285 (QMK35_00285) cch1 61797..63584 (-) 1788 WP_070373489.1 cassette chromosome replicative helicase -
  QMK35_RS00290 (QMK35_00290) ssb 63586..63822 (-) 237 WP_070373490.1 cassette chromosome ssDNA-binding protein -
  QMK35_RS00295 (QMK35_00295) - 64025..65563 (-) 1539 WP_204186964.1 hypothetical protein -
  QMK35_RS00300 (QMK35_00300) - 65673..66836 (+) 1164 WP_285159723.1 helix-turn-helix domain-containing protein -
  QMK35_RS00305 (QMK35_00305) - 66849..66977 (+) 129 WP_269322899.1 hypothetical protein -
  QMK35_RS00310 (QMK35_00310) - 67090..67653 (+) 564 WP_285159724.1 abortive infection family protein -
  QMK35_RS13580 - 67854..67997 (-) 144 WP_369077090.1 DUF1958 domain-containing protein -
  QMK35_RS00315 (QMK35_00315) - 68071..68826 (-) 756 WP_070373492.1 sulfite exporter TauE/SafE family protein -
  QMK35_RS00320 (QMK35_00320) cstR 68826..69086 (-) 261 WP_070373493.1 persulfide-sensing transcriptional repressor CstR -
  QMK35_RS00325 (QMK35_00325) cstA 69224..70291 (+) 1068 WP_075100270.1 persulfide response sulfurtransferase CstA -
  QMK35_RS00330 (QMK35_00330) cstB 70320..71654 (+) 1335 WP_285159725.1 persulfide dioxygenase-sulfurtransferase CstB -
  QMK35_RS00335 (QMK35_00335) chrA 71847..73010 (-) 1164 WP_070373496.1 chromate efflux transporter -
  QMK35_RS00340 (QMK35_00340) - 73021..73323 (-) 303 WP_025905228.1 PadR family transcriptional regulator -
  QMK35_RS00345 (QMK35_00345) arsC 73449..73850 (-) 402 WP_075100272.1 arsenate reductase (thioredoxin) -
  QMK35_RS00350 (QMK35_00350) arsB 73868..75160 (-) 1293 WP_285159960.1 arsenite efflux transporter membrane subunit ArsB -
  QMK35_RS00355 (QMK35_00355) - 75157..75474 (-) 318 WP_011274435.1 metalloregulator ArsR/SmtB family transcription factor -
  QMK35_RS00360 (QMK35_00360) - 75743..77803 (+) 2061 WP_025905371.1 heavy metal translocating P-type ATPase -
  QMK35_RS00365 (QMK35_00365) - 77821..78366 (+) 546 WP_037537668.1 YdhK family protein -
  QMK35_RS00370 (QMK35_00370) - 78677..80092 (+) 1416 WP_103322421.1 hypothetical protein -
  QMK35_RS00375 (QMK35_00375) - 80115..80837 (-) 723 WP_103322422.1 site-specific DNA-methyltransferase -
  QMK35_RS00380 (QMK35_00380) - 80854..81729 (-) 876 WP_239102456.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
  QMK35_RS00385 (QMK35_00385) - 81746..82771 (-) 1026 WP_239102458.1 DNA adenine methylase -
  QMK35_RS00390 (QMK35_00390) - 82874..83386 (-) 513 WP_103323364.1 DUF1643 domain-containing protein -
  QMK35_RS00395 (QMK35_00395) - 83402..83713 (-) 312 WP_103323363.1 DUF960 family protein -
  QMK35_RS00400 (QMK35_00400) - 83809..84147 (-) 339 WP_103323362.1 SAUGI family uracil-DNA glycosylase inhibitor -
  QMK35_RS00405 (QMK35_00405) ccrB 84622..86247 (-) 1626 WP_285159726.1 cassette chromosome recombinase CcrB Machinery gene
  QMK35_RS00410 (QMK35_00410) ccrA 86269..87618 (-) 1350 WP_040030082.1 cassette chromosome recombinase CcrA Machinery gene
  QMK35_RS00415 (QMK35_00415) - 87796..88053 (-) 258 WP_002434121.1 hypothetical protein -
  QMK35_RS00420 (QMK35_00420) cch1 88118..89908 (-) 1791 WP_210127845.1 cassette chromosome replicative helicase -
  QMK35_RS00425 (QMK35_00425) - 89908..90177 (-) 270 WP_031838353.1 hypothetical protein -
  QMK35_RS00430 (QMK35_00430) - 90332..91891 (-) 1560 WP_194376024.1 hypothetical protein -
  QMK35_RS00435 (QMK35_00435) - 91993..92835 (+) 843 WP_194440955.1 toll/interleukin-1 receptor domain-containing protein -
  QMK35_RS00440 (QMK35_00440) - 92933..93298 (+) 366 Protein_86 helix-turn-helix transcriptional regulator -
  QMK35_RS00445 (QMK35_00445) - 93256..94023 (-) 768 WP_107517540.1 alpha/beta fold hydrolase -
  QMK35_RS00450 (QMK35_00450) - 94155..94424 (+) 270 WP_228481256.1 hypothetical protein -
  QMK35_RS00455 (QMK35_00455) - 94555..95559 (-) 1005 WP_021339370.1 NADP-dependent oxidoreductase -
  QMK35_RS00460 (QMK35_00460) - 95749..96090 (+) 342 WP_002506307.1 MerR family transcriptional regulator -
  QMK35_RS00465 (QMK35_00465) - 96163..96522 (+) 360 WP_021339372.1 DUF1304 domain-containing protein -
  QMK35_RS00470 (QMK35_00470) - 96597..96749 (-) 153 WP_285159727.1 hypothetical protein -
  QMK35_RS00475 (QMK35_00475) - 97033..97164 (+) 132 WP_264291862.1 hypothetical protein -
  QMK35_RS00480 (QMK35_00480) - 97222..97395 (+) 174 WP_157948031.1 hypothetical protein -
  QMK35_RS00485 (QMK35_00485) - 97571..97831 (+) 261 WP_107520697.1 hypothetical protein -
  QMK35_RS00490 (QMK35_00490) - 97865..98677 (+) 813 WP_107393048.1 helix-turn-helix domain-containing protein -
  QMK35_RS00495 (QMK35_00495) - 98691..100166 (+) 1476 WP_107393055.1 DUF6038 family protein -
  QMK35_RS00500 (QMK35_00500) - 100393..101493 (+) 1101 WP_107393049.1 hypothetical protein -
  QMK35_RS00505 (QMK35_00505) - 101486..101854 (+) 369 WP_037576907.1 hypothetical protein -
  QMK35_RS00510 (QMK35_00510) - 101854..103497 (+) 1644 WP_070038559.1 DUF5906 domain-containing protein -
  QMK35_RS00515 (QMK35_00515) ccrC 103722..105398 (+) 1677 WP_192945136.1 cassette chromosome recombinase CcrC -

Sequence


Protein


Download         Length: 449 a.a.        Molecular weight: 52155.08 Da        Isoelectric Point: 9.8417

>NTDB_id=838661 QMK35_RS00275 WP_210124230.1 59891..61240(-) (ccrA) [Staphylococcus cohnii strain SDAQ-1]
MKQSIGYLRQSTHKQQSLAAQKLTIKALAERYHIQHITFYSDKQSGRTDKRDGYKQITELIQQGNCDILCCYRLNRLHRN
LKNALTLIKLCQKHHVHILSVHDGYFDMDKSFDRLKLNIFMSLAELESDNIGEQVKNGLREKAKQGKLITTHAPFGYHYQ
NGTFIINNDESPTVKAVFNYYLQGYGYKKIAQYLEDDNKLITRKPYQVRNIIMNPNYCGRVINQYGQYNNMVPPIVSTTI
YEHAQAIRNKKQFHCIPSENKLKQKIKCPYCGSTLTNMTIRKTNHSLRYYVCPKNMNASRFVCDFKGINAENLEKQVLES
CQKFFRDQQLYSKIKHAIEKQLKKQMMYDTSNTLTHEKIIEKLAQGTIDVETFREQSQSINLQNKPIQPISDIGIKASLQ
KVIQKSFTLNMLYPFIDVIHITKNKELSGIYLKDEPLNIVNQAVQSSTA

Nucleotide


Download         Length: 1350 bp        

>NTDB_id=838661 QMK35_RS00275 WP_210124230.1 59891..61240(-) (ccrA) [Staphylococcus cohnii strain SDAQ-1]
ATGAAACAATCAATTGGTTATTTACGCCAAAGTACACACAAACAACAATCACTCGCGGCACAAAAATTAACGATTAAAGC
ATTAGCTGAAAGGTATCATATTCAGCATATTACCTTCTATAGTGACAAACAGTCTGGGCGTACAGACAAGCGTGATGGAT
ACAAACAGATTACCGAACTTATCCAACAGGGTAACTGTGACATATTGTGTTGTTACCGACTAAATAGACTACATCGTAAT
TTGAAAAACGCATTAACACTCATTAAGTTATGTCAAAAACACCATGTTCATATATTGAGTGTACATGATGGCTATTTTGA
TATGGATAAATCCTTTGATCGTCTAAAACTCAATATTTTCATGAGTCTGGCTGAACTTGAATCCGATAATATTGGTGAAC
AAGTCAAAAATGGTCTTAGAGAAAAGGCAAAACAAGGTAAACTCATAACGACCCATGCGCCTTTCGGTTATCACTATCAA
AATGGTACTTTCATCATTAATAACGATGAATCACCTACCGTCAAAGCTGTATTCAATTATTATCTTCAAGGATATGGCTA
CAAGAAGATTGCACAATATTTAGAAGACGATAATAAACTTATTACCCGCAAGCCTTATCAGGTACGAAATATTATTATGA
ACCCAAATTATTGTGGTCGTGTCATCAATCAATATGGTCAATATAACAATATGGTTCCACCTATTGTTTCGACAACAATA
TATGAACATGCTCAAGCAATCCGTAATAAGAAACAATTTCACTGTATACCGTCAGAGAATAAACTGAAACAAAAAATCAA
ATGTCCTTATTGTGGTTCAACCCTTACCAACATGACCATTAGAAAAACCAATCATTCATTACGTTATTATGTCTGTCCTA
AAAACATGAATGCATCACGTTTTGTATGTGACTTTAAAGGCATAAACGCTGAAAACCTAGAAAAACAGGTCTTAGAATCT
TGCCAAAAATTCTTTCGAGACCAACAGCTCTATTCGAAAATTAAACATGCTATTGAGAAACAGCTCAAAAAACAAATGAT
GTATGATACTAGTAACACATTAACTCATGAAAAGATCATTGAAAAATTAGCTCAAGGAACAATTGATGTAGAAACATTCA
GAGAACAATCTCAATCAATAAACCTACAGAATAAACCTATACAACCAATAAGTGATATTGGGATAAAAGCATCACTACAA
AAGGTTATACAGAAAAGTTTCACGTTAAACATGTTATATCCCTTTATTGATGTCATTCATATTACTAAAAATAAAGAACT
AAGCGGCATCTATTTAAAAGATGAGCCACTAAACATTGTTAATCAAGCGGTACAATCATCAACTGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ccrA Staphylococcus aureus COL

75.168

99.555

0.748

  ccrA Staphylococcus aureus N315

71.492

100

0.715