Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   QPL78_RS12710 Genome accession   NZ_CP126530
Coordinates   2477656..2478039 (-) Length   127 a.a.
NCBI ID   WP_284559284.1    Uniprot ID   -
Organism   Bacillus halotolerans strain Tehuacan_S4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2472656..2483039
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPL78_RS12670 (QPL78_12670) sinI 2473591..2473764 (+) 174 WP_024122036.1 anti-repressor SinI family protein Regulator
  QPL78_RS12675 (QPL78_12675) sinR 2473798..2474133 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QPL78_RS12680 (QPL78_12680) tasA 2474220..2475005 (-) 786 WP_101864524.1 biofilm matrix protein TasA -
  QPL78_RS12685 (QPL78_12685) - 2475070..2475654 (-) 585 WP_284559282.1 signal peptidase I -
  QPL78_RS12690 (QPL78_12690) tapA 2475626..2476387 (-) 762 WP_284559283.1 amyloid fiber anchoring/assembly protein TapA -
  QPL78_RS12695 (QPL78_12695) - 2476664..2476987 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  QPL78_RS12700 (QPL78_12700) - 2477030..2477209 (-) 180 WP_003236949.1 YqzE family protein -
  QPL78_RS12705 (QPL78_12705) comGG 2477281..2477655 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  QPL78_RS12710 (QPL78_12710) comGF 2477656..2478039 (-) 384 WP_284559284.1 competence type IV pilus minor pilin ComGF Machinery gene
  QPL78_RS12715 (QPL78_12715) comGE 2478065..2478412 (-) 348 WP_284559285.1 competence type IV pilus minor pilin ComGE Machinery gene
  QPL78_RS12720 (QPL78_12720) comGD 2478396..2478827 (-) 432 WP_255003480.1 competence type IV pilus minor pilin ComGD Machinery gene
  QPL78_RS12725 (QPL78_12725) comGC 2478817..2479113 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  QPL78_RS12730 (QPL78_12730) comGB 2479127..2480164 (-) 1038 WP_284559286.1 competence type IV pilus assembly protein ComGB Machinery gene
  QPL78_RS12735 (QPL78_12735) comGA 2480151..2481221 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  QPL78_RS12740 (QPL78_12740) - 2481543..2481953 (-) 411 WP_185848827.1 CBS domain-containing protein -
  QPL78_RS12745 (QPL78_12745) - 2482016..2482969 (-) 954 WP_284559287.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14621.81 Da        Isoelectric Point: 7.9272

>NTDB_id=838490 QPL78_RS12710 WP_284559284.1 2477656..2478039(-) (comGF) [Bacillus halotolerans strain Tehuacan_S4]
MLISGSLAIFFHLFLSRQQENEGFMQREWVISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFEFYHSMIRKRVDG
KGHVPILDHIKTMKAGVKNGMLWLKVKNENDKEYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=838490 QPL78_RS12710 WP_284559284.1 2477656..2478039(-) (comGF) [Bacillus halotolerans strain Tehuacan_S4]
TTGCTCATATCAGGATCGTTAGCGATATTCTTTCATCTATTTTTGTCACGTCAACAGGAGAATGAGGGCTTCATGCAACG
GGAATGGGTCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAGTCGCAGACAGTGCAGACAGATGAGCATGGCAGCG
TCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAATTCTACCATTCAATGATCAGAAAAAGAGTAGACGGA
AAAGGGCATGTTCCGATTCTTGACCATATTAAAACAATGAAAGCCGGGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAA
GAATGAGAATGATAAAGAGTATCAAACCGCTTTTCCGGTATATACGTCGTTAGGAGGTGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

72.441

100

0.724