Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   VDS57_RS04420 Genome accession   NZ_CP141839
Coordinates   809812..809952 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PN1236     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 804812..814952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VDS57_RS04395 (VDS57_04395) yuxO 805089..805469 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  VDS57_RS04400 (VDS57_04400) comA 805488..806132 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  VDS57_RS04405 (VDS57_04405) comP 806213..808525 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  VDS57_RS04410 (VDS57_04410) comX 808541..808762 (-) 222 WP_014480704.1 competence pheromone ComX -
  VDS57_RS04415 (VDS57_04415) comQ 808764..809627 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  VDS57_RS04420 (VDS57_04420) degQ 809812..809952 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  VDS57_RS04425 (VDS57_04425) - 810174..810299 (+) 126 WP_003228793.1 hypothetical protein -
  VDS57_RS04430 (VDS57_04430) - 810414..810782 (+) 369 WP_046381300.1 hypothetical protein -
  VDS57_RS04435 (VDS57_04435) pdeH 810758..811987 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  VDS57_RS04440 (VDS57_04440) pncB 812123..813595 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  VDS57_RS04445 (VDS57_04445) pncA 813611..814162 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  VDS57_RS04450 (VDS57_04450) yueI 814259..814657 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=838307 VDS57_RS04420 WP_003220708.1 809812..809952(-) (degQ) [Bacillus subtilis strain PN1236]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=838307 VDS57_RS04420 WP_003220708.1 809812..809952(-) (degQ) [Bacillus subtilis strain PN1236]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1