Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   U7118_RS09690 Genome accession   NZ_CP141283
Coordinates   1795385..1795768 (+) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain DKU_09     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1790385..1800768
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U7118_RS09655 (U7118_09655) corA 1790839..1791792 (+) 954 WP_014480260.1 magnesium transporter CorA -
  U7118_RS09660 (U7118_09660) - 1791794..1791991 (+) 198 WP_014480259.1 CBS domain-containing protein -
  U7118_RS09665 (U7118_09665) comGA 1792203..1793273 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  U7118_RS09670 (U7118_09670) comGB 1793260..1794297 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  U7118_RS09675 (U7118_09675) comGC 1794311..1794607 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  U7118_RS09680 (U7118_09680) comGD 1794597..1795028 (+) 432 WP_324271586.1 comG operon protein ComGD Machinery gene
  U7118_RS09685 (U7118_09685) comGE 1795012..1795359 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  U7118_RS09690 (U7118_09690) comGF 1795385..1795768 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  U7118_RS09695 (U7118_09695) comGG 1795769..1796134 (+) 366 WP_324271587.1 ComG operon protein ComGG Machinery gene
  U7118_RS09700 (U7118_09700) spoIITA 1796213..1796392 (+) 180 WP_014480252.1 YqzE family protein -
  U7118_RS09705 (U7118_09705) yqzG 1796434..1796760 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  U7118_RS09710 (U7118_09710) tapA 1797032..1797793 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  U7118_RS09715 (U7118_09715) sipW 1797777..1798349 (+) 573 WP_003230181.1 signal peptidase I SipW -
  U7118_RS09720 (U7118_09720) tasA 1798413..1799198 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  U7118_RS09725 (U7118_09725) sinR 1799291..1799626 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U7118_RS09730 (U7118_09730) sinI 1799660..1799833 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=836715 U7118_RS09690 WP_014480254.1 1795385..1795768(+) (comGF) [Bacillus subtilis strain DKU_09]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=836715 U7118_RS09690 WP_014480254.1 1795385..1795768(+) (comGF) [Bacillus subtilis strain DKU_09]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984