Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH19_RS15060 Genome accession   NZ_CP126104
Coordinates   3066523..3066663 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MB7_B11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3061523..3071663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH19_RS15035 (QNH19_15035) - 3061869..3062252 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  QNH19_RS15040 (QNH19_15040) comA 3062274..3062918 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QNH19_RS15045 (QNH19_15045) comP 3062999..3065299 (-) 2301 WP_283887092.1 histidine kinase Regulator
  QNH19_RS15050 (QNH19_15050) comX 3065313..3065486 (-) 174 WP_012118314.1 competence pheromone ComX -
  QNH19_RS15055 (QNH19_15055) - 3065455..3066315 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  QNH19_RS15060 (QNH19_15060) degQ 3066523..3066663 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QNH19_RS15065 (QNH19_15065) - 3067128..3067469 (+) 342 WP_069006914.1 hypothetical protein -
  QNH19_RS15070 (QNH19_15070) - 3067476..3068699 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  QNH19_RS15075 (QNH19_15075) - 3068829..3070295 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  QNH19_RS15080 (QNH19_15080) - 3070313..3070864 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  QNH19_RS15085 (QNH19_15085) - 3070961..3071359 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=836122 QNH19_RS15060 WP_003152043.1 3066523..3066663(-) (degQ) [Bacillus velezensis strain MB7_B11]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=836122 QNH19_RS15060 WP_003152043.1 3066523..3066663(-) (degQ) [Bacillus velezensis strain MB7_B11]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891