Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH41_RS16825 Genome accession   NZ_CP126100
Coordinates   3249412..3249552 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain LN2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3244412..3254552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH41_RS16800 (QNH41_16800) - 3244763..3245143 (-) 381 WP_283912554.1 hotdog fold thioesterase -
  QNH41_RS16805 (QNH41_16805) comA 3245161..3245805 (-) 645 WP_168748642.1 two-component system response regulator ComA Regulator
  QNH41_RS16810 (QNH41_16810) comP 3245886..3248183 (-) 2298 WP_255001792.1 histidine kinase Regulator
  QNH41_RS16815 (QNH41_16815) comX 3248191..3248352 (-) 162 WP_255001794.1 competence pheromone ComX -
  QNH41_RS16820 (QNH41_16820) - 3248367..3249227 (-) 861 WP_255001796.1 polyprenyl synthetase family protein -
  QNH41_RS16825 (QNH41_16825) degQ 3249412..3249552 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  QNH41_RS16830 (QNH41_16830) - 3250013..3250381 (+) 369 WP_106019478.1 hypothetical protein -
  QNH41_RS16835 (QNH41_16835) - 3250357..3251586 (-) 1230 WP_255001801.1 EAL and HDOD domain-containing protein -
  QNH41_RS16840 (QNH41_16840) - 3251722..3253191 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  QNH41_RS16845 (QNH41_16845) - 3253207..3253758 (-) 552 WP_106019480.1 isochorismatase family cysteine hydrolase -
  QNH41_RS16850 (QNH41_16850) - 3253855..3254253 (-) 399 WP_106019481.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=835916 QNH41_RS16825 WP_024122683.1 3249412..3249552(-) (degQ) [Bacillus halotolerans strain LN2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=835916 QNH41_RS16825 WP_024122683.1 3249412..3249552(-) (degQ) [Bacillus halotolerans strain LN2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978