Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   QNH41_RS13350 Genome accession   NZ_CP126100
Coordinates   2594182..2594565 (-) Length   127 a.a.
NCBI ID   WP_038954226.1    Uniprot ID   -
Organism   Bacillus halotolerans strain LN2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2589182..2599565
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH41_RS13310 (QNH41_13310) sinI 2590117..2590290 (+) 174 WP_024122036.1 anti-repressor SinI family protein Regulator
  QNH41_RS13315 (QNH41_13315) sinR 2590324..2590659 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNH41_RS13320 (QNH41_13320) tasA 2590746..2591531 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  QNH41_RS13325 (QNH41_13325) - 2591596..2592180 (-) 585 WP_105955579.1 signal peptidase I -
  QNH41_RS13330 (QNH41_13330) tapA 2592152..2592913 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  QNH41_RS13335 (QNH41_13335) - 2593190..2593513 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  QNH41_RS13340 (QNH41_13340) - 2593556..2593735 (-) 180 WP_003236949.1 YqzE family protein -
  QNH41_RS13345 (QNH41_13345) comGG 2593807..2594181 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  QNH41_RS13350 (QNH41_13350) comGF 2594182..2594565 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  QNH41_RS13355 (QNH41_13355) comGE 2594591..2594938 (-) 348 WP_106020095.1 competence type IV pilus minor pilin ComGE Machinery gene
  QNH41_RS13360 (QNH41_13360) comGD 2594922..2595353 (-) 432 WP_255003480.1 competence type IV pilus minor pilin ComGD Machinery gene
  QNH41_RS13365 (QNH41_13365) comGC 2595343..2595639 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  QNH41_RS13370 (QNH41_13370) comGB 2595653..2596690 (-) 1038 WP_106020096.1 competence type IV pilus assembly protein ComGB Machinery gene
  QNH41_RS13375 (QNH41_13375) comGA 2596677..2597747 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  QNH41_RS13380 (QNH41_13380) - 2598068..2598478 (-) 411 WP_106020097.1 CBS domain-containing protein -
  QNH41_RS13385 (QNH41_13385) - 2598541..2599494 (-) 954 WP_095713277.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14587.79 Da        Isoelectric Point: 7.9272

>NTDB_id=835895 QNH41_RS13350 WP_038954226.1 2594182..2594565(-) (comGF) [Bacillus halotolerans strain LN2]
MLISGSLAIFFHLFLSRQQENEGFMQREWVISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFEIYHSMIRKRVDG
KGHVPILDHIKTMKAGVKNGMLWLKVKNENDKEYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=835895 QNH41_RS13350 WP_038954226.1 2594182..2594565(-) (comGF) [Bacillus halotolerans strain LN2]
TTGCTCATATCAGGATCGTTAGCGATATTCTTTCATCTATTTTTGTCACGTCAACAGGAGAATGAGGGCTTCATGCAGCG
GGAATGGGTCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAGTCGCAGACAGTGCAGACAGATGAGCATGGCAGCG
TCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAAATCTACCATTCAATGATCAGAAAAAGAGTAGACGGA
AAAGGGCATGTTCCGATTCTTGATCATATTAAAACAATGAAAGCCGGGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAA
GAATGAGAATGATAAAGAGTATCAAACCGCTTTTCCGGTATATACGTCGTTAGGAGGTGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

73.228

100

0.732