Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNK06_RS17435 Genome accession   NZ_CP126097
Coordinates   3247999..3248139 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KF24     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3242999..3253139
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK06_RS17410 (QNK06_17410) yuxO 3243341..3243721 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  QNK06_RS17415 (QNK06_17415) comA 3243740..3244384 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QNK06_RS17420 (QNK06_17420) comP 3244465..3246765 (-) 2301 WP_088300729.1 histidine kinase Regulator
  QNK06_RS17425 (QNK06_17425) comX 3246777..3246941 (-) 165 WP_015384519.1 competence pheromone ComX -
  QNK06_RS17430 (QNK06_17430) - 3246954..3247814 (-) 861 WP_128422373.1 polyprenyl synthetase family protein -
  QNK06_RS17435 (QNK06_17435) degQ 3247999..3248139 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QNK06_RS17440 (QNK06_17440) - 3248361..3248486 (+) 126 WP_144500545.1 hypothetical protein -
  QNK06_RS17445 (QNK06_17445) - 3248600..3248968 (+) 369 WP_144500544.1 hypothetical protein -
  QNK06_RS17450 (QNK06_17450) pdeH 3248944..3250173 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QNK06_RS17455 (QNK06_17455) pncB 3250310..3251782 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QNK06_RS17460 (QNK06_17460) pncA 3251798..3252349 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  QNK06_RS17465 (QNK06_17465) yueI 3252446..3252844 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=835739 QNK06_RS17435 WP_003220708.1 3247999..3248139(-) (degQ) [Bacillus subtilis strain KF24]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=835739 QNK06_RS17435 WP_003220708.1 3247999..3248139(-) (degQ) [Bacillus subtilis strain KF24]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1