Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH31_RS16055 Genome accession   NZ_CP126094
Coordinates   3099476..3099616 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain G2S2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3094476..3104616
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH31_RS16030 (QNH31_16030) yuxO 3094819..3095199 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  QNH31_RS16035 (QNH31_16035) comA 3095218..3095862 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QNH31_RS16040 (QNH31_16040) comP 3095943..3098243 (-) 2301 WP_041850586.1 histidine kinase Regulator
  QNH31_RS16045 (QNH31_16045) comX 3098255..3098419 (-) 165 WP_015384519.1 competence pheromone ComX -
  QNH31_RS16050 (QNH31_16050) - 3098432..3099292 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  QNH31_RS16055 (QNH31_16055) degQ 3099476..3099616 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QNH31_RS16060 (QNH31_16060) - 3099838..3099900 (+) 63 Protein_3094 hypothetical protein -
  QNH31_RS16065 (QNH31_16065) - 3100079..3100447 (+) 369 WP_041850584.1 hypothetical protein -
  QNH31_RS16070 (QNH31_16070) pdeH 3100423..3101652 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QNH31_RS16075 (QNH31_16075) pncB 3101789..3103261 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QNH31_RS16080 (QNH31_16080) pncA 3103277..3103828 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  QNH31_RS16085 (QNH31_16085) yueI 3103925..3104323 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=835566 QNH31_RS16055 WP_003220708.1 3099476..3099616(-) (degQ) [Bacillus subtilis strain G2S2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=835566 QNH31_RS16055 WP_003220708.1 3099476..3099616(-) (degQ) [Bacillus subtilis strain G2S2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1