Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH21_RS14820 Genome accession   NZ_CP126090
Coordinates   2889034..2889174 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain CEW AP102     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2884034..2894174
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH21_RS14775 (QNH21_14775) - 2884601..2885080 (+) 480 WP_024423318.1 Na+/H+ antiporter subunit E -
  QNH21_RS14780 (QNH21_14780) - 2885080..2885361 (+) 282 WP_024423319.1 Na(+)/H(+) antiporter subunit F1 -
  QNH21_RS14785 (QNH21_14785) mnhG 2885345..2885719 (+) 375 WP_024423320.1 monovalent cation/H(+) antiporter subunit G -
  QNH21_RS14790 (QNH21_14790) - 2885811..2886200 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  QNH21_RS14795 (QNH21_14795) comA 2886224..2886865 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  QNH21_RS14800 (QNH21_14800) - 2886946..2887467 (-) 522 Protein_2853 sensor histidine kinase -
  QNH21_RS14805 (QNH21_14805) - 2887436..2887747 (-) 312 WP_283907330.1 PDZ domain-containing protein -
  QNH21_RS14810 (QNH21_14810) comX 2887801..2887971 (-) 171 WP_073207246.1 competence pheromone ComX -
  QNH21_RS14815 (QNH21_14815) - 2887968..2888882 (-) 915 WP_024423324.1 polyprenyl synthetase family protein -
  QNH21_RS14820 (QNH21_14820) degQ 2889034..2889174 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  QNH21_RS14825 (QNH21_14825) - 2889680..2890036 (+) 357 WP_151039930.1 inner spore coat protein -
  QNH21_RS14830 (QNH21_14830) - 2890072..2891298 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  QNH21_RS14835 (QNH21_14835) - 2891436..2892908 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  QNH21_RS14840 (QNH21_14840) - 2892926..2893477 (-) 552 WP_024423328.1 isochorismatase family cysteine hydrolase -
  QNH21_RS14845 (QNH21_14845) - 2893538..2893945 (-) 408 WP_103131554.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=835312 QNH21_RS14820 WP_003213123.1 2889034..2889174(-) (degQ) [Bacillus safensis strain CEW AP102]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=835312 QNH21_RS14820 WP_003213123.1 2889034..2889174(-) (degQ) [Bacillus safensis strain CEW AP102]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696