Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8570_RS02390 | Genome accession | NZ_AP026932 |
| Coordinates | 479066..479215 (+) | Length | 49 a.a. |
| NCBI ID | WP_001813641.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PZ900701549 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 474066..484215
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8570_RS02350 (PC1528_04680) | comA/nlmT | 475062..475649 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8570_RS02355 (PC1528_04690) | blpU | 475930..476160 (+) | 231 | WP_001093268.1 | bacteriocin-like peptide BlpU | - |
| R8570_RS02360 | - | 476163..476282 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| R8570_RS02365 (PC1528_04700) | - | 476579..476743 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| R8570_RS02370 (PC1528_04710) | - | 476740..477144 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| R8570_RS02375 | - | 477342..478147 (+) | 806 | Protein_466 | IS5 family transposase | - |
| R8570_RS02380 (PC1528_04740) | blpM | 478349..478603 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| R8570_RS02385 (PC1528_04750) | blpN | 478619..478822 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| R8570_RS02390 (PC1528_04760) | cipB | 479066..479215 (+) | 150 | WP_001813641.1 | bacteriocin-like peptide BlpO | Regulator |
| R8570_RS02395 | - | 479319..479438 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8570_RS02400 (PC1528_04780) | - | 480224..480607 (+) | 384 | WP_000877378.1 | hypothetical protein | - |
| R8570_RS02405 (PC1528_04790) | - | 480659..481348 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8570_RS02410 (PC1528_04800) | blpZ | 481390..481623 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| R8570_RS02415 | - | 481774..482385 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8570_RS02420 (PC1528_04810) | ccrZ | 482546..483340 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| R8570_RS02425 (PC1528_04820) | trmB | 483337..483972 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5164.93 Da Isoelectric Point: 3.9133
>NTDB_id=83495 R8570_RS02390 WP_001813641.1 479066..479215(+) (cipB) [Streptococcus pneumoniae strain PZ900701549]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=83495 R8570_RS02390 WP_001813641.1 479066..479215(+) (cipB) [Streptococcus pneumoniae strain PZ900701549]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
48.98 |
100 |
0.49 |