Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QNK08_RS12555 Genome accession   NZ_CP125983
Coordinates   2343398..2343781 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain ZKY04     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2338398..2348781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK08_RS12515 (QNK08_12525) sinI 2339332..2339505 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK08_RS12520 (QNK08_12530) sinR 2339539..2339874 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK08_RS12525 (QNK08_12535) tasA 2339967..2340752 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QNK08_RS12530 (QNK08_12540) sipW 2340816..2341388 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QNK08_RS12535 (QNK08_12545) tapA 2341372..2342133 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QNK08_RS12540 (QNK08_12550) yqzG 2342405..2342731 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK08_RS12545 (QNK08_12555) spoIITA 2342773..2342952 (-) 180 WP_014480252.1 YqzE family protein -
  QNK08_RS12550 (QNK08_12560) comGG 2343023..2343397 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QNK08_RS12555 (QNK08_12565) comGF 2343398..2343781 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QNK08_RS12560 (QNK08_12570) comGE 2343807..2344154 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QNK08_RS12565 (QNK08_12575) comGD 2344138..2344569 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  QNK08_RS12570 (QNK08_12580) comGC 2344559..2344855 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QNK08_RS12575 (QNK08_12585) comGB 2344869..2345906 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  QNK08_RS12580 (QNK08_12590) comGA 2345893..2346963 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QNK08_RS12585 (QNK08_12595) - 2347175..2347372 (-) 198 WP_014480259.1 CBS domain-containing protein -
  QNK08_RS12590 (QNK08_12600) corA 2347374..2348327 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=834067 QNK08_RS12555 WP_014480254.1 2343398..2343781(-) (comGF) [Bacillus subtilis strain ZKY04]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=834067 QNK08_RS12555 WP_014480254.1 2343398..2343781(-) (comGF) [Bacillus subtilis strain ZKY04]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984