Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QNK08_RS12515 Genome accession   NZ_CP125983
Coordinates   2339332..2339505 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ZKY04     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2334332..2344505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK08_RS12500 (QNK08_12510) gcvT 2335131..2336219 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  QNK08_RS12505 (QNK08_12515) hepAA 2336661..2338334 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  QNK08_RS12510 (QNK08_12520) yqhG 2338355..2339149 (+) 795 WP_264379318.1 YqhG family protein -
  QNK08_RS12515 (QNK08_12525) sinI 2339332..2339505 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK08_RS12520 (QNK08_12530) sinR 2339539..2339874 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK08_RS12525 (QNK08_12535) tasA 2339967..2340752 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QNK08_RS12530 (QNK08_12540) sipW 2340816..2341388 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QNK08_RS12535 (QNK08_12545) tapA 2341372..2342133 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QNK08_RS12540 (QNK08_12550) yqzG 2342405..2342731 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK08_RS12545 (QNK08_12555) spoIITA 2342773..2342952 (-) 180 WP_014480252.1 YqzE family protein -
  QNK08_RS12550 (QNK08_12560) comGG 2343023..2343397 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QNK08_RS12555 (QNK08_12565) comGF 2343398..2343781 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QNK08_RS12560 (QNK08_12570) comGE 2343807..2344154 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=834064 QNK08_RS12515 WP_003230187.1 2339332..2339505(+) (sinI) [Bacillus subtilis strain ZKY04]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=834064 QNK08_RS12515 WP_003230187.1 2339332..2339505(+) (sinI) [Bacillus subtilis strain ZKY04]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1