Detailed information NTG0833895

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: SR852_RS11665
• Genome accession: NZ_CP140161
• Coordinates: 2288349..2288786 (+)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain ATCC 14580
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2283349..2293786

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SR852_RS11630 (SR852_11630)	-	2283879..2284124 (-)	246	WP_003183483.1	DUF2626 domain-containing protein	-
SR852_RS11635 (SR852_11635)	-	2284333..2284710 (+)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
SR852_RS11645 (SR852_11645)	-	2284952..2285791 (+)	840	WP_003183480.1	STAS domain-containing protein	-
SR852_RS11650 (SR852_11650)	comGA	2285948..2287012 (+)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
SR852_RS11655 (SR852_11655)	comGB	2287002..2288036 (+)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
SR852_RS11660 (SR852_11660)	comGC	2288050..2288343 (+)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
SR852_RS11665 (SR852_11665)	comGD	2288349..2288786 (+)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
SR852_RS11670 (SR852_11670)	comGE	2288770..2289117 (+)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
SR852_RS11675 (SR852_11675)	comGF	2289143..2289514 (+)	372	WP_003183461.1	competence type IV pilus minor pilin ComGF	Machinery gene
SR852_RS11680 (SR852_11680)	comGG	2289527..2289892 (+)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
SR852_RS11685 (SR852_11685)	-	2289981..2290163 (+)	183	WP_003183456.1	YqzE family protein	-
SR852_RS11690 (SR852_11690)	-	2290193..2290513 (-)	321	WP_003183454.1	YqzG/YhdC family protein	-
SR852_RS11695 (SR852_11695)	tapA	2290790..2291518 (+)	729	WP_011198112.1	amyloid fiber anchoring/assembly protein TapA	-
SR852_RS11700 (SR852_11700)	sipW	2291515..2292099 (+)	585	WP_003183449.1	signal peptidase I SipW	-
SR852_RS11705 (SR852_11705)	tasA	2292173..2292967 (+)	795	WP_003183447.1	biofilm matrix protein TasA	-
SR852_RS11710 (SR852_11710)	sinR	2293072..2293407 (-)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
SR852_RS11715 (SR852_11715)	sinI	2293441..2293617 (-)	177	WP_003183444.1	anti-repressor SinI	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=833895 SR852_RS11665 WP_009327905.1 2288349..2288786(+) (comGD) [Bacillus licheniformis strain ATCC 14580]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=833895 SR852_RS11665 WP_009327905.1 2288349..2288786(+) (comGD) [Bacillus licheniformis strain ATCC 14580]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393