Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   SR852_RS11675 Genome accession   NZ_CP140161
Coordinates   2289143..2289514 (+) Length   123 a.a.
NCBI ID   WP_003183461.1    Uniprot ID   -
Organism   Bacillus licheniformis strain ATCC 14580     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2284143..2294514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SR852_RS11635 (SR852_11635) - 2284333..2284710 (+) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  SR852_RS11645 (SR852_11645) - 2284952..2285791 (+) 840 WP_003183480.1 STAS domain-containing protein -
  SR852_RS11650 (SR852_11650) comGA 2285948..2287012 (+) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  SR852_RS11655 (SR852_11655) comGB 2287002..2288036 (+) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  SR852_RS11660 (SR852_11660) comGC 2288050..2288343 (+) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  SR852_RS11665 (SR852_11665) comGD 2288349..2288786 (+) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  SR852_RS11670 (SR852_11670) comGE 2288770..2289117 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  SR852_RS11675 (SR852_11675) comGF 2289143..2289514 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  SR852_RS11680 (SR852_11680) comGG 2289527..2289892 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  SR852_RS11685 (SR852_11685) - 2289981..2290163 (+) 183 WP_003183456.1 YqzE family protein -
  SR852_RS11690 (SR852_11690) - 2290193..2290513 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  SR852_RS11695 (SR852_11695) tapA 2290790..2291518 (+) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  SR852_RS11700 (SR852_11700) sipW 2291515..2292099 (+) 585 WP_003183449.1 signal peptidase I SipW -
  SR852_RS11705 (SR852_11705) tasA 2292173..2292967 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  SR852_RS11710 (SR852_11710) sinR 2293072..2293407 (-) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  SR852_RS11715 (SR852_11715) sinI 2293441..2293617 (-) 177 WP_003183444.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 123 a.a.        Molecular weight: 14179.31 Da        Isoelectric Point: 10.3094

>NTDB_id=833896 SR852_RS11675 WP_003183461.1 2289143..2289514(+) (comGF) [Bacillus licheniformis strain ATCC 14580]
MFVAGTMASIFHLFLSPERNGSDIHPREWTITAEQILKESRNSIDIRSAGDHQSLAMTNRQGDTVRYEQYQTVIRKRVNG
KGHVPLLQHVKKMRFMIENHLLILEATSLSGKSYRTSIPLYHM

Nucleotide


Download         Length: 372 bp        

>NTDB_id=833896 SR852_RS11675 WP_003183461.1 2289143..2289514(+) (comGF) [Bacillus licheniformis strain ATCC 14580]
ATGTTCGTTGCAGGTACGATGGCCTCGATATTTCATCTGTTTTTATCCCCGGAAAGAAACGGTTCGGATATTCACCCCCG
TGAATGGACGATTACTGCCGAGCAAATATTGAAGGAGTCTAGGAATTCGATTGACATAAGAAGTGCCGGTGATCATCAGT
CACTAGCGATGACAAACCGCCAAGGTGACACCGTTCGCTATGAGCAATATCAGACAGTTATTCGAAAAAGGGTCAATGGA
AAAGGTCATGTGCCTCTATTACAGCATGTCAAAAAAATGAGGTTTATGATTGAAAATCACCTGCTGATCCTTGAAGCGAC
AAGTCTAAGCGGCAAATCATACCGCACGTCTATTCCGCTCTATCATATGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

38.843

98.374

0.382