Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QMY17_RS05905 Genome accession   NZ_CP125812
Coordinates   1120496..1120636 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N3378-3At     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1115496..1125636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMY17_RS05875 yueI 1115792..1116190 (+) 399 WP_014480710.1 YueI family protein -
  QMY17_RS05880 pncA 1116287..1116838 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  QMY17_RS05885 pncB 1116854..1118326 (+) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  QMY17_RS05890 pdeH 1118462..1119691 (+) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  QMY17_RS05895 - 1119667..1120035 (-) 369 WP_014477834.1 hypothetical protein -
  QMY17_RS05900 - 1120149..1120274 (-) 126 WP_003228793.1 hypothetical protein -
  QMY17_RS05905 degQ 1120496..1120636 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QMY17_RS05910 - 1120821..1121684 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  QMY17_RS05915 comX 1121686..1121907 (+) 222 WP_014480704.1 competence pheromone ComX -
  QMY17_RS05920 comP 1121923..1124235 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  QMY17_RS05925 comA 1124316..1124960 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QMY17_RS05930 yuxO 1124979..1125359 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=832921 QMY17_RS05905 WP_003220708.1 1120496..1120636(+) (degQ) [Bacillus subtilis strain N3378-3At]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=832921 QMY17_RS05905 WP_003220708.1 1120496..1120636(+) (degQ) [Bacillus subtilis strain N3378-3At]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1