Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   QLQ05_RS05105 Genome accession   NZ_CP125762
Coordinates   994762..994929 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain KRS015     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 989762..999929
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ05_RS05075 pncB 989907..991379 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QLQ05_RS05080 pdeH 991516..992745 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QLQ05_RS05085 - 992721..993089 (-) 369 WP_003243784.1 hypothetical protein -
  QLQ05_RS05090 - 993203..993328 (-) 126 WP_003228793.1 hypothetical protein -
  QLQ05_RS05095 degQ 993550..993690 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QLQ05_RS05100 comQ 993875..994774 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  QLQ05_RS05105 comX 994762..994929 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  QLQ05_RS05110 comP 994944..997252 (+) 2309 Protein_1005 two-component system sensor histidine kinase ComP -
  QLQ05_RS05115 comA 997333..997977 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QLQ05_RS05120 yuxO 997996..998376 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  QLQ05_RS05125 mnhG 998415..998789 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  QLQ05_RS05130 mrpF 998773..999057 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  QLQ05_RS05135 mrpE 999057..999533 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=832688 QLQ05_RS05105 WP_003242801.1 994762..994929(+) (comX) [Bacillus subtilis strain KRS015]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=832688 QLQ05_RS05105 WP_003242801.1 994762..994929(+) (comX) [Bacillus subtilis strain KRS015]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1