Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QL281_RS02750 Genome accession   NZ_CP125292
Coordinates   497155..497328 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM117797     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 492155..502328
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QL281_RS02735 (QL281_02735) gcvT 492955..494043 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  QL281_RS02740 (QL281_02740) yqhH 494484..496157 (+) 1674 WP_017696203.1 SNF2-related protein -
  QL281_RS02745 (QL281_02745) yqhG 496178..496972 (+) 795 WP_017696202.1 YqhG family protein -
  QL281_RS02750 (QL281_02750) sinI 497155..497328 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QL281_RS02755 (QL281_02755) sinR 497362..497697 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QL281_RS02760 (QL281_02760) tasA 497790..498575 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  QL281_RS02765 (QL281_02765) sipW 498640..499212 (-) 573 WP_072557060.1 signal peptidase I -
  QL281_RS02770 (QL281_02770) tapA 499196..499951 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  QL281_RS02775 (QL281_02775) yqzG 500222..500548 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  QL281_RS02780 (QL281_02780) spoIIT 500590..500769 (-) 180 WP_014480252.1 YqzE family protein -
  QL281_RS02785 (QL281_02785) comGG 500840..501214 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  QL281_RS02790 (QL281_02790) comGF 501215..501598 (-) 384 WP_041334965.1 ComG operon protein ComGF Machinery gene
  QL281_RS02795 (QL281_02795) comGE 501624..501971 (-) 348 WP_041334967.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=830874 QL281_RS02750 WP_003230187.1 497155..497328(+) (sinI) [Bacillus subtilis strain SRCM117797]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=830874 QL281_RS02750 WP_003230187.1 497155..497328(+) (sinI) [Bacillus subtilis strain SRCM117797]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1