Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QLX65_RS12820 Genome accession   NZ_CP125289
Coordinates   2596310..2596747 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain SF334     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2591310..2601747
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLX65_RS12770 (QLX65_12770) sinI 2591694..2591867 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QLX65_RS12775 (QLX65_12775) sinR 2591901..2592236 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QLX65_RS12780 (QLX65_12780) - 2592284..2593069 (-) 786 WP_003153102.1 TasA family protein -
  QLX65_RS12785 (QLX65_12785) - 2593133..2593717 (-) 585 WP_012117977.1 signal peptidase I -
  QLX65_RS12790 (QLX65_12790) tapA 2593689..2594360 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  QLX65_RS12795 (QLX65_12795) - 2594620..2594949 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  QLX65_RS12800 (QLX65_12800) - 2594989..2595168 (-) 180 WP_003153093.1 YqzE family protein -
  QLX65_RS12805 (QLX65_12805) comGG 2595225..2595602 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  QLX65_RS12810 (QLX65_12810) comGF 2595603..2595998 (-) 396 WP_283002417.1 competence type IV pilus minor pilin ComGF -
  QLX65_RS12815 (QLX65_12815) comGE 2596012..2596326 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  QLX65_RS12820 (QLX65_12820) comGD 2596310..2596747 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  QLX65_RS12825 (QLX65_12825) comGC 2596737..2597003 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  QLX65_RS12830 (QLX65_12830) comGB 2597050..2598087 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  QLX65_RS12835 (QLX65_12835) comGA 2598074..2599144 (-) 1071 WP_044053465.1 competence type IV pilus ATPase ComGA Machinery gene
  QLX65_RS12840 (QLX65_12840) - 2599336..2600286 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  QLX65_RS12845 (QLX65_12845) - 2600432..2601733 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=830753 QLX65_RS12820 WP_044053464.1 2596310..2596747(-) (comGD) [Bacillus velezensis strain SF334]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=830753 QLX65_RS12820 WP_044053464.1 2596310..2596747(-) (comGD) [Bacillus velezensis strain SF334]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566