Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QLX65_RS12770 Genome accession   NZ_CP125289
Coordinates   2591694..2591867 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SF334     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2586694..2596867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLX65_RS12755 (QLX65_12755) gcvT 2587512..2588612 (-) 1101 WP_044053463.1 glycine cleavage system aminomethyltransferase GcvT -
  QLX65_RS12760 (QLX65_12760) - 2589035..2590705 (+) 1671 WP_003153107.1 SNF2-related protein -
  QLX65_RS12765 (QLX65_12765) - 2590723..2591517 (+) 795 WP_003153106.1 YqhG family protein -
  QLX65_RS12770 (QLX65_12770) sinI 2591694..2591867 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QLX65_RS12775 (QLX65_12775) sinR 2591901..2592236 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QLX65_RS12780 (QLX65_12780) - 2592284..2593069 (-) 786 WP_003153102.1 TasA family protein -
  QLX65_RS12785 (QLX65_12785) - 2593133..2593717 (-) 585 WP_012117977.1 signal peptidase I -
  QLX65_RS12790 (QLX65_12790) tapA 2593689..2594360 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  QLX65_RS12795 (QLX65_12795) - 2594620..2594949 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  QLX65_RS12800 (QLX65_12800) - 2594989..2595168 (-) 180 WP_003153093.1 YqzE family protein -
  QLX65_RS12805 (QLX65_12805) comGG 2595225..2595602 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  QLX65_RS12810 (QLX65_12810) comGF 2595603..2595998 (-) 396 WP_283002417.1 competence type IV pilus minor pilin ComGF -
  QLX65_RS12815 (QLX65_12815) comGE 2596012..2596326 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  QLX65_RS12820 (QLX65_12820) comGD 2596310..2596747 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=830749 QLX65_RS12770 WP_003153105.1 2591694..2591867(+) (sinI) [Bacillus velezensis strain SF334]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=830749 QLX65_RS12770 WP_003153105.1 2591694..2591867(+) (sinI) [Bacillus velezensis strain SF334]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702